KEGG   Brassica napus (rape): 106351523Help
Entry
106351523         CDS       T04128                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bna03110]
    106351523
Enzymes [BR:bna01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106351523
Chaperones and folding catalysts [BR:bna03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    106351523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 106351523
NCBI-ProteinID: XP_013646768
UniProt: A0A078FTA7
AA seq 143 aa AA seqDB search
MGKDAKGGGKGKGKQASGSDEAAASKGKGKSGKAADGLGTCTYVKARHVLCEKQGKINEA
YKKLQDGWLSNGDKVPPAEFAKIAAEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFNTPV
GVTSAPFKSTHGYHIILSEGRKN
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagacgcaaaaggtggagggaagggtaagggaaagcaagcaagcggcagtgat
gaagctgctgcctccaagggtaaaggcaaatctggaaaagccgctgatggtctcggaacc
tgcacttatgttaaagcgagacacgttttgtgtgaaaagcaagggaagatcaacgaggca
tacaaaaagttgcaagatggttggttgagcaatggagacaaggttcctcctgctgagttt
gcaaagattgcagcagagtactcagagtgcccatcagggaaaaaaggaggagatcttgga
tggttccctagaggaaagatggcaggtcccttccaagatgttgccttcaacacacctgtt
ggtgtcaccagtgctcctttcaaatctacgcacggataccacatcatcctgtctgaagga
aggaagaattga

DBGET integrated database retrieval system