KEGG   Brassica napus (rape): 106352534Help
Entry
106352534         CDS       T04128                                 

Definition
(RefSeq) bifunctional fucokinase/fucose pyrophosphorylase
  KO
K05305  fucokinase [EC:2.7.1.52]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106352534
   00520 Amino sugar and nucleotide sugar metabolism
    106352534
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     106352534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 106352534
NCBI-ProteinID: XP_013647602
AA seq 1061 aa AA seqDB search
MSGSSRNNQQRKKADLATILRKSWYHLRLSVRHPTRVPTWDAILLTAASPEQAELYDWQL
RRAKRMGRIADSTVTLAVPDPDGKRIGSGAATLNAIYALALHYQKLGFDPVASEEEVANG
SCAQSSPMSWVRFLSEKHVLMLHAGGDSKRVPWANPMGKVFLPLPFLASDDPDGPVPLLF
DHILALASSARHAFGDQGGLFIMTGDVLPCFDAFKMTLPEDSASIVTVPITLDIASNHGV
VVTSKSESLAEGFTVSLVNDLLQKPTVEELVKKDAILHDGRTLLDTGIISARGKAWLDLV
ALGCSCQPMISELLGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGEHLVNSLGKQKMYSYC
TYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASCVILSSEIAPGVSI
GEDSLIYDSTVSGAVQIGSQSVVVGIHIPSEAPESFRFMLPDRHCLWEVPLVGHKERVIV
YCGLHDNPKNSIHKDGTFCGKPLEKVLCDLGIEESDLWSLNASSQERYLWNAKMFPILTY
SEMLKLASWLMGLDDGRNKEKIALWRSSKRVSLEELHGSINFPEMCSGSSNHQADLAAGI
AKACVNYGMLGRNLSQLCHEILQKESLGLEICKKFLDQCPKFQEQNSRILPKSRAYQVEV
DLLRACGDEAKALDLEHRVWEAVAEETASAVRYGFREHLLESSGKPPSEKNHISLSQPRR
TKVELPVRVDFVGGWSDTPPWSLERAGCVLNMAITLEGSLPIGTIIETTNEKSGISIQDD
AGNALHIEDPRTIKTPFEVNDPFRLVKSALLVTGVVQEHSTGLAIKTWANVPRGSGLGTS
SILAAAVVKGLLQISDGDESNENVARLVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPG
IPLRLQVVPLLASPQLVSELQQRLLVVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRL
AELAKAGREALMNCEVDELGEIMSEAWRLHQELDPYCSNEFVDKLFAFSQPYSSGFKLVG
AGGGGFSLILAKDAEKAKELRQRLEEHPEFDVKVYNWSISL
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatcctcgagaaacaaccagcagaggaagaaggccgacctcgccacgatcctc
cgcaagtcgtggtaccatttgcgtctctcggttcgccatcccaccagagtccccacttgg
gatgcgatcctcctcactgccgccagtcccgagcaggccgagctctacgactggcagctc
cggagagccaagcgtatggggaggatagctgactccaccgtcactttggccgttcctgat
ccagacggcaagcggatcggctccggcgctgccactcttaacgccatctacgctctcgct
ctgcattatcagaaattaggtttcgatccagttgcttcagaggaggaagttgcaaatggt
agttgtgctcagtcctctcccatgtcttgggttagattcctctctgagaagcatgtgttg
atgcttcatgctggaggtgactccaagagagtgccttgggctaatcccatgggcaaagtc
ttcctcccacttccttttcttgcttccgatgatcctgatggtcctgttcctctcctcttt
gatcatatccttgctctcgcttcgtctgcaaggcacgccttcggtgatcaaggtggattg
ttcattatgaccggtgatgtccttccatgtttcgatgcttttaaaatgactctccctgaa
gactcggcctccattgttactgtgcccatcactcttgatattgcttccaaccacggtgtt
gtcgtcacatccaaatctgagtctcttgctgaagggtttactgttagtttagtgaatgat
cttctccagaagcctacagtagaagagcttgtcaagaaagatgcaattttgcatgacgga
cggacgctccttgacactgggatcatatctgcgaggggaaaagcatggttggatctggtc
gctcttggatgctcctgccaaccgatgatctcagagcttttaggcagtaaaaaagagatg
agtttgtatgaagatctggtggctgcttgggttccctcaaggcatgattggctgcgaacc
cgacctttgggggaacaccttgtcaacagtctagggaagcaaaagatgtacagctactgc
acctatgatttgcagtttttgcattttggaacatcaagtgaggtactggaccacttgagc
ggagatgcttcaggaatcgtaggtcgaaggcacttatgttccatccccgcaactacggtt
tccgacatcgcagcctcttgtgtcatcttgtctagtgaaattgcgcctggtgtctccatt
ggtgaagactcgcttatatatgattcaacagtctccggtgctgtacaaatcggttcacag
tccgtagttgtcggtattcacatcccaagtgaagctccagagagtttcaggttcatgctt
cctgataggcattgtctctgggaggttccattggtgggacacaaggagagagtcattgtc
tactgtggtctccatgataatccaaagaactcaattcacaaagacggaactttctgcggt
aaaccgttagagaaagtactttgtgatctcggcatcgaggaaagtgacctctggagcttg
aacgcatcatcacaagagagatatttgtggaatgctaaaatgtttcccattctcacatac
agcgaaatgctgaagctagcgtcgtggctgatgggtctagatgatggtagaaacaaggag
aagatagccttgtggagaagctcgaaacgtgtgagcttagaagagctgcacggatcgata
aacttccctgagatgtgcagtggctccagcaatcaccaagctgatctcgcggctgggatt
gctaaagcatgtgtgaactatggtatgcttgggagaaacttgtctcagctctgccatgag
attttacagaaagagtcactaggactggagatatgcaagaagtttctggatcaatgtccc
aaatttcaggaacagaactctagaattcttccaaagagtcgtgcatatcaggtggaagtt
gatcttctgagagcatgtggggatgaggcaaaggcgttagacttggagcatagagtatgg
gaagcagttgcggaagaaactgcttcagctgtgagatatggttttagagaacatctcttg
gaatcaagcggcaagcctccttctgagaagaatcatatttctctttctcaaccaagaagg
acgaaagttgaactaccagttcgggtagattttgtaggaggttggagtgatacacctcca
tggagtttagagcgtgcgggttgcgtcctgaacatggcaataactttggaaggctcactt
cccattggcacaatcatcgagacaacgaatgagaagagtggaatctcaatccaagacgac
gctggaaacgctctacacatcgaagatccaagaaccatcaagacaccctttgaagttaac
gatccattcaggcttgttaaatccgctctattggtaaccggcgttgttcaagaacactcc
acagggttagcaataaagacgtgggctaatgttccgcgtggaagcggtctaggaacctcc
agcatcctagctgcagctgttgtgaaaggacttttgcagatatctgatggagatgaaagc
aatgagaacgttgcgaggctggtcttggttttggagcagctcatgggtactggaggtggc
tggcaagatcagataggtgggctatacccagggatcaaattcacttcaagctttccaggg
atccctctacgtctccaagttgttcctttactcgcatcgccgcagctggtctcagagttg
cagcaacgtctcctcgttgtcttcactggtcaagtcaggctagctcaccaagtcctacac
aaggttgtaacaaggtatctacaaagagacaatctcttgatatcaagcataaagcgtttg
gccgagctggcgaaagccgggagagaagcgttgatgaactgtgaagtggatgagcttggg
gagataatgtcagaggcttggagattgcatcaagagcttgatccgtattgcagcaacgag
tttgtggacaagcttttcgcgttttcgcaaccttatagctcaggcttcaagctcgtgggt
gcaggtgggggaggattctcgcttatactggctaaggacgcagagaaggctaaggagttg
aggcagagattggaagagcatccagagtttgatgtcaaagtttataattggagtatctct
ctctaa

KEGG   Brassica napus (rape): 106377357Help
Entry
106377357         CDS       T04128                                 

Definition
(RefSeq) bifunctional fucokinase/fucose pyrophosphorylase-like
  KO
K05305  fucokinase [EC:2.7.1.52]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106377357
   00520 Amino sugar and nucleotide sugar metabolism
    106377357
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     106377357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 106377357
NCBI-ProteinID: XP_013673033
AA seq 1061 aa AA seqDB search
MAGSSRNNKQRKKADLATILRKSWYHLRLSVRHPTRVPTWDAILLTAASPEQAELYDWQL
RRAKRMGRIADSTVTLAVPDPDGKRIGSGAATLNAIYALALHYQKLGFDPIASEEEVANG
RCAQSSPMSWVRFLSEKHVLMLHAGGDSKRVPWANPMGKVFLPLPFLASDDPDGPVPLLF
DHILALASSARHAFGDQGGLFIMTGDVLPCFDAFKMTLPEDSASIVTVPITLDIASNHGV
IVTSTSESLAEGFTVSLVNDLLQKPTVEELVKKDAILHDGQTLLDTGIISARGRAWLDLV
ALGCSCQPMISELLGCKKEMSLYEDLVAAWVPSRHDWLRTRPLGDHLVNSLGRQKMYSYC
TYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASCAILSSEIAPGVSI
GEDSLIYDSTVSGAVQIGSQSVVVGIHIPSEAPESFRFMLPDRHCLWEVPLVGHKERVIV
YCGLHDNPKNSIHKDATFCGKPLEKVLCDLGIEESDLWNFKASSQERCLWNAKMFPILTY
SEMLKLASWLMGLDDGRSKEKIALWRSAKRVSLEELHGSINFPEMCSGSSNHQADLAAGI
AKACVNYGMLGRNLSQLCHEILQKESLGLEICKKFLDQCPKFQEQNSRILPKSRAYQVEV
DLLRACGDEAKAIELEHKVWEAIAEETASAVRYGFREHLLESSGKPPSEKNHISLSQPRR
TKVELPVRVDFVGGWSDTPPWSLERAGCVLNMAITLEGSLPIGTIIETTNEKSGISIQDD
AGNALHIEDPRTIKTPFEVNDPFRLVKSALLVTGIVQEHSTRLAIKTWANVPRGSGLGTS
SILAAAVVKGLLQISDGDESNENVARLVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPG
IPLRLQVVPLLASPQLISELQQRLLVVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRL
TELAKAGREALMNCEVDELGEIMSEAWRLHQELDPYCSNEFVDRLFAFSQPYSSGFKLVG
AGGGGFSLILAKDAEKAKELRQRLEEHPEFDVKIYDWSISL
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatcctcgagaaacaacaaacagaggaagaaggctgacctcgccacgatcctc
cgcaagtcgtggtaccatttgcgtctctccgtgcgccatcccaccagggtccccacttgg
gatgcgatcctcctcactgccgccagtcccgagcaggccgagctctacgactggcagctc
cgtagagccaagcgtatgggacgtatagctgactccaccgtcactttggccgttcctgat
ccagacggcaagcggatcggctccggcgctgccactcttaacgccatctacgctctcgct
ctgcattatcagaaattagggttcgatcccattgcttcagaggaggaagttgcaaatggt
aggtgtgctcagtcctctcccatgtcttgggttagattcctctctgagaagcatgtgttg
atgcttcatgctggaggtgactccaagagagtgccttgggctaatcccatgggcaaagtc
ttcctcccacttccttttcttgcttccgatgatcctgatggtcctgttcctctccttttt
gatcacattcttgctctcgcttcatctgcaaggcacgccttcggtgatcaaggtggattg
ttcattatgaccggggatgtccttccatgtttcgatgcttttaaaatgactctccctgaa
gactcggcctccattgttactgtgcccatcactcttgatattgcttccaaccacggtgtc
atcgtcacatccacatccgagtctcttgccgaagggtttactgtcagtttagtgaatgat
cttctccagaagcctacagtagaggagcttgtcaagaaagatgcaattttgcatgacgga
cagacgctcctcgacactgggatcatatctgcgaggggcagagcatggttggatctggtc
gctcttggatgctcctgccaaccgatgatctcagagcttttaggctgtaaaaaagagatg
agtttgtatgaagatctggtggctgcttgggttccctcaaggcatgattggctacgaacc
cgacctttaggagatcaccttgtcaacagtctagggaggcaaaagatgtacagctattgc
acgtatgatttgcagtttttacattttggaacatcaagtgaggtactggaccacttgagc
ggagatgcttcaggaatcgtaggtcgaaggcacttatgttccatccccgcaactacggtt
tccgatattgcagcctcttgtgccatcttgtctagtgaaattgcgcctggtgtctccatt
ggtgaagactcgcttatatatgattcaacagtctctggtgctgtacaaatcggttcccag
tccgtagttgttggcattcacatcccaagtgaagctccagagagtttcaggttcatgctt
ccggacaggcattgtctctgggaggtcccgttggtgggacacaaggagagagtcattgtc
tactgtggtctccacgataatccaaagaactcgattcacaaagacgcaactttctgcggt
aaaccgttagagaaagtactctgtgatcttggcatcgaggaaagtgacctctggaacttc
aaagcatcatcacaagagagatgtttgtggaatgctaaaatgttccccattctcacatac
agtgaaatgctgaagctagcgtcgtggctgatgggtttagatgatgggagaagcaaggag
aagatagccttgtggagaagcgcaaaacgtgtgagcttagaagagctgcacggatcgata
aacttccctgagatgtgcagtggctccagcaatcatcaagctgatctcgcggcgggaatc
gctaaagcgtgtgtgaactatggtatgcttgggaggaatttgtctcaactctgccatgag
attttacagaaagagtcactaggattggagatatgcaagaagtttctggatcaatgtccc
aaatttcaggaacaaaactctagaattcttccaaagagtcgtgcatatcaggtggaagtt
gatcttctgagagcatgtggggatgaggcaaaggcgatagagttggaacataaagtctgg
gaagcaattgcggaagaaactgcttcagctgtgagatatggttttagagaacatctcttg
gaatcaagcggcaagcctccttctgagaagaatcatatctctctttctcaaccaagaagg
acgaaagttgaactaccagttcgtgtagactttgtaggaggttggagtgatacacctcca
tggagtttagagcgtgcgggctgcgtcctcaacatggcaataaccttagaaggctcactt
cccatcggcacaatcatcgagacaacgaatgagaagagtggaatctcaatccaagacgac
gctggaaacgctctacacatcgaagatccaagaaccatcaagacaccctttgaagttaac
gatccattcaggcttgttaaatctgctctgttggtaaccggcattgttcaagaacactcc
acaaggttagcaataaagacgtgggctaatgttcctcgtggcagcggtctaggaacctct
agcatcctagctgcagctgttgtgaaaggacttttgcagatatctgatggagatgaaagc
aatgagaatgttgcgaggctcgtcttggttctggagcagctcatgggtactggaggtggc
tggcaagatcagataggtggattatacccagggatcaaattcacttcaagctttcctgga
atccctctgcgtcttcaagttgttcctttactcgcatctccacagctgatctcagagttg
cagcaacgcctcctcgttgttttcactggtcaagtcaggctagctcaccaagtcctacac
aaggttgtaacaaggtatctacaaagagataacctcttgatatcaagcataaagcgtttg
accgagctggcgaaagccgggagagaagcgttgatgaactgtgaagtggatgagcttggg
gagataatgtcagaggcttggagattgcatcaagagcttgatccgtattgcagcaatgag
tttgtggacaggctatttgcgttttcgcagccttatagctcaggtttcaagcttgtgggt
gcagggggtggaggattctcgcttatattggctaaggacgcagagaaggctaaggagttg
aggcagagattggaagagcatccggagtttgatgtcaaaatttatgattggagtatctct
ctctaa

DBGET integrated database retrieval system