KEGG   Brassica napus (rape): 106352898Help
Entry
106352898         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106352898
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106352898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106352898
NCBI-ProteinID: XP_013648004
AA seq 323 aa AA seqDB search
MTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTACVNSFGDEQL
AVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDPLDGSSIVDTNFT
VGTIFGVWPGDKLTGVTGADQVAAAMGIYGPRTTYVLAVKGFPGTHEFLLLDEGKWQHVK
ETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVNQIIVKEKGIF
TNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGYKSVLDKTIVNLDDRTQVAYGSKNE
IIRFEETLYATSRLKNVPIGATA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtgtgaaattggtcaaagcttggaagagtttttgacacaagcaacacctgac
aagggtttgagaactttgctgatgtgtatgggagaagcattgaggacaatagctttcaaa
gtcaggacagcttcttgtggtggaacagcttgtgttaattcctttggagatgaacaactc
gctgtcgatatgctcgccgacaagcttctctttgaggctttgcaatactcgcatgtgtgt
aagtacgcttgctctgaagaagtacctgagcttcaagacatgggaggtccagtggaaggt
ggctttagtgtagcatttgatccattggatggatccagcattgtggatacgaacttcact
gtgggaaccatatttggggtttggcctggtgataagttaaccggagtcactggggcagat
caagtggctgcagccatgggaatctatggtccaagaaccacttatgttttggctgttaaa
gggtttcctggaactcatgagttcttgcttcttgatgaagggaaatggcagcatgttaag
gagacaacagagatcaatgaagggaaaatgttctcaccaggaaacttgagagccacgttt
gacaactccgaatacagcaagctgattgattactacgtgaaagagaagtacacactacga
tacacgggaggaatggttcctgacgttaaccagattattgtgaaggagaaaggaatcttc
acgaacgtgacgtctcctacggctaaggcaaagctgaggctgttgttcgaagtggctcct
cttggccttctcattgagaatgctggtggattcagtagtgatggatacaagtctgtgctt
gacaagaccatcgtcaacctcgacgatagaactcaagttgcctatggctcaaagaacgag
atcattcgcttcgaagaaaccctttacgcaacatcaagactcaagaatgttcccattgga
gctactgcttag

KEGG   Brassica napus (rape): 106360801Help
Entry
106360801         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic isoform X1
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106360801
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106360801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106360801
NCBI-ProteinID: XP_013655922
AA seq 394 aa AA seqDB search
METSVTCYSRGVLLPRVSSQRSPSLVTPPSSFSTSSSFKGLKSSSIFGDSLRVAPRSQLK
ATKPKSNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT
ACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDPL
DGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFL
LLDEGKWQHVKETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDV
NQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLVENAGGFSSDGYNSVLDKTIVNLDD
RTQVAYGSKNEIIRFEETLYGTSRLKNVPIGVTA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagactagcgtcacgtgctactcacgtggggtcctcctcccacgcgtttcttctcag
cgttccccttcattggttactcctccttcttccttctccacatcatccagcttcaagggt
ctgaagtcaagctcaatctttggagattcactcagagtagcaccaagatcgcagttgaaa
gccaccaagcccaagagcaatggtgcttcatctgtgaccaaatgtgaaattggtcaaagc
ttggaagagtttttgacacaagcaactccagacaagggattgagaactttgctgatgtgt
atgggagaagcattgaggacaatagctttcaaagtcaggacagcttcttgcggtggaaca
gcttgtgttaactcctttggtgatgaacaactcgctgtcgatatgctcgccgataagctt
ctctttgaggctttgcaatactcgcatgtgtgtaagtacgcgtgctcagaagaagtacct
gagcttcaagacatgggaggtccagtggaaggcgggtttagcgtggcgtttgatccattg
gatggttcgagcattgtggatacaaacttcactgtgggaactatctttggggtttggcct
ggtgacaagttaaccggagtcacgggaggagatcaagtggctgcagccatgggaatctat
ggtccaagaaccacttatgttttggctgttaaagggtttccaggaactcatgagttcttg
cttcttgatgaagggaaatggcagcatgttaaggagacaacagagattaatgaagggaag
atgttctcaccaggaaacttgagagccacgtttgacaactccgaatacagcaagctgatt
gattactacgtgaaagagaagtacacacttcgatacacaggaggaatggttcctgacgtt
aaccagattattgtgaaggagaaaggaatattcacgaacgtgacttcgcctacggctaag
gcaaagttgaggttgttgttcgaagtggctcctcttggcctgctcgttgagaatgctggt
ggattcagcagtgatggatacaactctgtgcttgacaagaccatcgtcaacctcgacgat
agaactcaagttgcttatggctcaaagaacgagatcatccgtttcgaagaaaccctttat
ggaacatcaagactcaagaatgttcccattggagttactgcttag

KEGG   Brassica napus (rape): 106376615Help
Entry
106376615         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic-like isoform X1
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106376615
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106376615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106376615
NCBI-ProteinID: XP_013672160
AA seq 395 aa AA seqDB search
METSVTCYSRGIILPSVSSQRSSTLVSPPPSFSASSSFKQRLKSSSIFGDSLRVAPRSQL
KATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGG
TACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDP
LDGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEF
LLLDEGKWQHVKETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPD
VNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGYNSVLDKTIVNLD
DRTQVAYGSKNEIIRFEETLYGTSRLKNVPIGANA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtcacatgctactcacgtgggatcatcctcccaagcgtctcttctcaa
cgatcatctacattggtttctcctcctccttccttctccgcatcatccagcttcaagcag
cgtctgaagtctagctcaatcttcggagattcactaagagtagcaccaagatcgcaattg
aaagccaccaaggccaagaacaatggtggttcgactgtgaccaaatgtgagattggtcaa
agcttggaagagtttttgagagaagcaacacctgacaagggattgagaactttgctgatg
tgtatgggagaagcgttgaggacaatagctttcaaagttaggacagcttcttgtggtgga
acagcttgtgttaattccttcggcgatgaacaactcgctgtcgatatgctcgccgataag
cttctctttgaggctttgcaatactcgcatgtgtgtaaatacgcttgctctgaagaagta
cctgagcttcaagacatgggaggtccagtggaaggtgggtttagcgtagcatttgatcca
ttggatggatcgagtattgtggatacaaacttcactgtgggaaccatatttggggtttgg
cctggtgacaagttaactggagtcacgggaggagatcaagtggctgcagctatgggtatc
tatggtccaagaaccacttatgtattggctgttaaagggtttccaggaactcatgagttc
ttgcttcttgatgaaggtaaatggcagcatgttaaggagacaacagagattaatgaaggg
aaaatgttctcaccaggaaacttgagagccacgtttgacaattctgaatacagcaagctg
attgattactacgtgaaagagaagtacacattgagatatacaggaggaatggttcctgac
gttaaccagattattgtgaaggagaaaggaatcttcacaaacgtgacttctcctacggct
aaggcaaagttgagactcttgttcgaagtggctcctttaggcctactcattgagaatgct
ggtggattcagcagtgatggatacaactctgtgcttgacaagaccatcgtcaacctcgac
gatagaactcaagttgcttatggctcaaagaacgagatcatccgcttcgaagaaaccctt
tacggaacatcaagactcaagaatgttcccattggagctaatgcttag

KEGG   Brassica napus (rape): 106414977Help
Entry
106414977         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106414977
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106414977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106414977
NCBI-ProteinID: XP_013711020
UniProt: A0A078GPV7
AA seq 393 aa AA seqDB search
METSVTCYSHGILLPRVSSQRSSSLVSPPSFSTSSSFKGLKSSSIFGDSLRVAPRSQLKA
TKAKSNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA
CVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPAEGGFSVAFDPLD
GSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFLL
LDEGKWQHVKETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVN
QIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLVENAGGFSSDGHNSVLDKTIVNLDDR
TQVAYGSKNEIIRFEETLYGTSRLKNVPIGVTA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagactagcgtcacgtgctactcacatgggatcctcctcccacgcgtttcttctcaa
cgttcctcttcattggtttctcctccttccttctccacatcatccagcttcaagggtctg
aagtcaagctcaatctttggagattcactcagagtagcaccaagatcgcagttgaaagcc
accaaggctaagagcaatggtgcttcatctgtgaccaaatgtgaaattggtcaaagcttg
gaagagtttttgacacaagcaactccagacaagggattgagaactttgctgatgtgtatg
ggagaagcattgaggacaatagctttcaaagtcaggacagcttcttgtggtggaacagct
tgtgttaactcctttggtgatgaacaactcgctgtcgatatgctcgctgacaagcttctc
tttgaggctttgcaatactcgcatgtgtgtaagtacgcatgctctgaagaagtacctgag
cttcaagacatgggtggtccagcggaaggtgggtttagtgtggcgttcgatccattggat
ggttcgagcattgtggatacaaacttcactgtgggaactatctttggggtttggcctggt
gacaagttaaccggagtcacgggaggagatcaagtggctgcagccatgggaatctatggt
ccaagaaccacttatgttttggctgttaaagggtttccaggaactcatgagttcttgctt
cttgatgaagggaagtggcagcatgttaaggagacaacagagatcaatgaagggaaaatg
ttctcaccaggaaacttgagagccacgtttgacaactctgaatacagcaagctgattgat
tactacgtgaaagagaagtacacacttcggtacacaggaggaatggttcctgacgttaac
cagattattgtgaaggagaaaggaatattcacgaacgtgacttcgcctacggctaaggca
aagttgaggttgttgttcgaagtggctcctcttggcctgctcgttgagaatgctggtggg
ttcagcagtgatggacacaactctgtgcttgacaagaccatcgtcaacctcgacgataga
actcaagttgcttatggttcaaagaacgagatcatccgtttcgaggaaaccctttatgga
acatcaagactcaagaatgttcccattggagttactgcttag

KEGG   Brassica napus (rape): 106445372Help
Entry
106445372         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic-like isoform X1
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445372
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106445372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106445372
NCBI-ProteinID: XP_013742367
AA seq 395 aa AA seqDB search
METSVTCYSRGIILPSVSSQRSSTLVSPPYSFSASSSFKQRLKSSSIFGESLRVAPRSQL
KATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGG
TACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDP
LDGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEF
LLLDEGKWQHVKETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPD
VNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGYKSVLDKTIVNLD
DRTQVAYGSKNEIIRFEETLYGTSRLKNVPIGANA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtcacatgctactcacgtgggatcatcctcccaagcgtttcttctcaa
cgatcatctacattggtttctcctccttattccttctccgcatcatccagcttcaagcag
cgtctgaagtctagctcaatcttcggagagtcactaagagtagcaccaagatcgcaattg
aaagccaccaaggctaagaacaatggtggttcgactgtgaccaaatgtgagattggtcaa
agcttggaagagtttttgagagaagcaacacctgacaagggattgagaactttgctgatg
tgtatgggagaagcgttgaggacaatagctttcaaagttaggacagcttcttgtggtggg
actgcttgtgttaattcctttggcgatgaacaactcgctgtcgatatgctcgccgataag
cttctctttgaggctttgcaatactcgcatgtgtgtaaatacgcttgctctgaagaagta
cctgagcttcaagacatgggaggtccagtggaaggtgggtttagtgtggcatttgatcca
ttggatggatccagcattgtggatacaaacttcactgtgggaaccatatttggggtttgg
cctggtgataagttaaccggagtcacgggaggagatcaagtggctgcagccatgggaatc
tatggtccaagaaccacttatgttttggctgttaaagggtttccaggaactcatgagttc
ttgcttcttgatgaaggtaaatggcagcatgttaaggagaccacagagattaatgaaggg
aaaatgttctcaccaggaaacttgagagccacgtttgacaattctgaatacagcaagctg
attgattactacgtgaaagagaagtacacattgagatatacaggaggaatggttcctgac
gttaaccagattattgtgaaggagaaaggaatcttcacaaacgtgacttctcctacggct
aaggcaaagttgagactcttgttcgaagtggctcctttaggcctactcattgagaatgct
ggtggattcagcagtgatggatacaagtctgtgcttgacaagaccatcgtcaacctcgac
gatagaactcaagttgcttatggctcaaagaacgagatcatccgctttgaagaaaccctt
tacggaacatcaagactcaagaatgttcccattggagctaatgcttag

KEGG   Brassica napus (rape): 106445373Help
Entry
106445373         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic-like isoform X1
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445373
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106445373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106445373
NCBI-ProteinID: XP_013742369
AA seq 310 aa AA seqDB search
METSVTCYSRGIILPSVSSQRSSTLVSPPYSFSASSSFKQRLKSSSIFGESLRVAPRSQL
KATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGG
TACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDP
LDGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEF
LLLDEGKWQHVKETTEINEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPD
VNQVCSSLAS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtcacatgctactcacgtgggatcatcctcccaagcgtttcttctcaa
cgatcatctacattggtttctcctccttattccttctccgcatcatccagcttcaagcag
cgtctgaagtctagctcaatcttcggagagtcactaagagtagcaccaagatcgcaattg
aaagccaccaaggctaagaacaatggtggttcgactgtgaccaaatgtgagattggtcaa
agcttggaagagtttttgagagaagcaacacctgacaagggattgagaactttgctgatg
tgtatgggagaagcgttgaggacaatagctttcaaagttaggacagcttcttgtggtggg
actgcttgtgttaattcctttggcgatgaacaactcgctgtcgatatgctcgccgataag
cttctctttgaggctttgcaatactcgcatgtgtgtaaatacgcttgctctgaagaagta
cctgagcttcaagacatgggaggtccagtggaaggtgggtttagtgtggcatttgatcca
ttggatggatccagcattgtggatacaaacttcactgtgggaaccatatttggggtttgg
cctggtgataagttaaccggagtcacgggaggagatcaagtggctgcagccatgggaatc
tatggtccaagaaccacttatgttttggctgttaaagggtttccaggaactcatgagttc
ttgcttcttgatgaaggtaaatggcagcatgttaaggagaccacagagattaatgaaggg
aaaatgttctcaccaggaaacttgagagccacgtttgacaattctgaatacagcaagctg
attgattactacgtgaaagagaagtacacattgagatatacaggaggaatggttcctgac
gttaaccaggtttgttcttctctggcaagctag

KEGG   Brassica napus (rape): 106447941Help
Entry
106447941         CDS       T04128                                 

Definition
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic-like
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
bna  Brassica napus (rape)
Pathway
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106447941
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     106447941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106447941
NCBI-ProteinID: XP_013745341
AA seq 229 aa AA seqDB search
METSVTCYSRGIILPSVSSQRSSTLVSPPYSFSASSSFKQRLKSSSIFGESLRVAPRSQL
KATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGG
TACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDP
LDGSSIVDTNFTVGTIFGVWPGDEEARFKTWSSFHKHQKEAPIIIFLRS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtcacatgctactcacgtgggatcatcctcccaagcgtttcttctcaa
cgatcatctacattggtttctcctccttattccttctccgcatcatccagcttcaagcag
cgtctgaagtctagctcaatcttcggagagtcactaagagtagcaccaagatcgcaattg
aaagccaccaaggctaagaacaatggtggttcgactgtgaccaaatgtgagattggtcaa
agcttggaagagtttttgagagaagcaacacctgacaagggattgagaactttgctgatg
tgtatgggagaagcgttgaggacaatagctttcaaagttaggacagcttcttgtggtggg
actgcttgtgttaattcctttggcgatgaacaactcgctgtcgatatgctcgccgataag
cttctctttgaggctttgcaatactcgcatgtgtgtaaatacgcttgctctgaagaagta
cctgagcttcaagacatgggaggtccagtggaaggtgggtttagtgtggcatttgatcca
ttggatggatccagcattgtggatacaaacttcactgtgggaaccatatttggggtttgg
cctggtgatgaggaggctagattcaagacgtggagttcatttcacaagcatcagaaggaa
gctcccattatcatatttctcagaagctaa

DBGET integrated database retrieval system