KEGG   Brassica napus (rape): 106353133Help
Entry
106353133         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106353133
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106353133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106353133
NCBI-ProteinID: XP_013648274
AA seq 592 aa AA seqDB search
MKVVDKIKSVTEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPSFCDITWGAGGSTA
DLTLEIASRMQNAICVETMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGQDK
FVQVEGGFACALDLVYHIRSKYGDYFGITVAGYPEAHPDVIEANGLATPESYQSDLAYLK
RKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNEEAVKAYGIHFATEMCKKILAHGITTLHIYTLNVDKSAIGILMNL
GLIDESKITRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPQGRWGDSRSA
SYSTLSDYQFMRPRARDKKLQQEWVVPLKGIEDVQEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLD
TLVEKSKAFSSITFMAVNKAENWVSNIGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYYLVSLVDNDYIDGDIFSVFA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgtcgacaagatcaaatccgtgacggagcaaggccaaaccgccttctccttc
gagttcttccctcccaagaccgaagacggcgtcgagaacctcttcgagcggatggatcgt
ctggtctcgtacgggcccagcttctgcgacatcacctggggagcaggaggatccaccgcg
gatctcaccctcgagatcgcgtcgaggatgcagaacgcgatctgcgtggagacgatgatg
catctcacgtgcaccaacatgccggtggagaagattgaccacgcgctggagacgatcaga
tctaatgggattcagaatgtgctggcgcttagaggggacccgcctcacgggcaggataag
ttcgttcaggtggagggagggtttgcttgtgctttggatctggtgtatcatattaggagc
aagtatggtgattactttgggattacggttgctggctatcctgaggctcatccggatgtg
attgaagctaatggacttgctactccggagtcttaccagagtgatcttgcttacctgaag
agaaaggttgatgctggagcggatctgattgtgactcagcttttctatgatactgatata
ttcctcaagtttgtgaatgactgtcggcaaattgggattaactgtcccattgttcctggg
attatgcccatttccaactacaaggggttcttgcgtatggctggtttctgcaagaccaag
atacctgctgagctcactgctgcattggagcctatcaaggataatgaggaagctgtgaag
gcctatggtattcactttgcaactgagatgtgcaaaaagattctggcccatggaatcacc
acccttcatatctacacacttaacgtggacaaatcagctattggaatactaatgaacctt
ggtctgattgatgagtctaaaatcactcgttctttaccttggagacgccctgcaaatgtt
ttccgtaccaaggaagatgttcgccccattttctgggcaaaccgtccaaagagctacata
tctaggacaaagggctggaatgacttcccacagggacgatggggtgattcacgcagtgca
tcatatagtacactttcggattatcagttcatgcgcccacgagcacgtgacaagaagctt
cagcaagaatgggttgtcccattgaaaggcattgaagatgttcaagagaaattcaaagag
ctctgtcttggaaacttaaaaagcagtccgtggtctgagttagatggactccagccagaa
acaaagatcataaacgagcaactcggaaaaataaactccaacggcttcctgaccatcaat
agccaaccatcagtcaatgcagccaaatccgattccccagctattggatggggtggacct
ggtggttacgtctaccagaaagcttaccttgagttcttctgctctaaggataagctagac
acacttgtggagaaatccaaagctttttcttctatcaccttcatggccgtgaacaaagca
gagaattgggtatcaaacattggtgaatccgatgtgaatgcagttacttggggagtgttc
ccagctaaggaggttatccaaccgacaattgttgatccagcaagtttcaaagtctggaaa
gacgaagcctttgagatttggtcaagaagctgggctaacttgtacccagaagatgaccct
tctagaaagttgctcgaggaggtgaagaacagctactatttggtaagcttagtggacaac
gattacatcgacggtgatatattctccgtctttgcttga

KEGG   Brassica napus (rape): 106368417Help
Entry
106368417         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106368417
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106368417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106368417
NCBI-ProteinID: XP_013663828
UniProt: A0A078HWP8
AA seq 592 aa AA seqDB search
MKVVDKIKSATEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPSFCDITWGAGGSTA
DLTLEIASRMQNAICVETMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGEDK
FVQVEGGFACALDLVNHVRSKYGDYFGITVAGYPEAHPDVIEADGLATPESYQSDLAYLK
KKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNEEAVKAFGIHFATEMCKKILAHGITTLHIYTLNMDKSAIGILMNL
GLIDESKITRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPQGRWGDSRSA
SYGTLSDYQFMRPRARDKKLQQEWVVPLKGIEDVQEKFKELCLGSLKSSPWSELDGLQPE
TKIINEKLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSRDKLD
TIVEKSKAFPSITYMAVNKAGNWVSNVGEADVNAVTWGVFPAKEIIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYFLVSLVDNDYINGDIFSVFA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagtcgacaagatcaaatccgcgacggagcaaggccaaaccgccttctccttc
gaattcttcccgccgaagaccgaagatggcgtcgagaatctcttcgaacggatggatcgt
ctggtctcgtacggaccttccttctgcgacatcacctggggcgccggaggatccaccgcc
gatctcacgctcgagatcgcctcgaggatgcagaacgcgatctgcgtggagacgatgatg
catctcacctgcaccaacatgcctgtggagaagatcgaccacgcgctcgagacgattaga
tccaacgggattcagaacgtgctcgcgcttagaggggacccgcctcatggggaggataag
ttcgttcaggtggaaggagggttcgcttgtgcgttggatctggtgaatcatgttaggagc
aagtatggtgattactttgggatcactgttgctggttatcccgaggctcatccggatgtg
attgaagctgatgggcttgcgactcctgagtcttatcagagtgatcttgcttatctgaag
aaaaaggttgatgctggagcggatctgattgtgactcagctgttttatgatactgatatt
ttcctcaagtttgtgaatgactgtcggcaaattgggattaattgtcccattgttcctggg
attatgcccatttctaactacaaggggttcttgcgtatggctggtttctgcaagaccaag
atacctgctgagctcactgctgcgttggagcctatcaaggataatgaagaagctgttaag
gcctttggtattcactttgcaacagaaatgtgcaaaaagattttggctcatggaatcact
acccttcatatctacaccttgaacatggacaaatcagctattgggatattaatgaacctt
ggtctgattgatgagtcaaaaattactcgttctttaccttggagacgccctgcaaatgtt
ttccgaactaaggaagatgttcgccccattttctgggcaaaccgtccaaagagctacata
tctagaacaaaaggctggaacgacttcccacagggacggtggggtgattctcgcagtgca
tcgtatggtacactttcggattatcagttcatgcgcccacgtgcacgtgacaagaagctt
cagcaagaatgggtcgtcccattgaaaggcattgaagacgttcaagagaaattcaaggag
ctctgccttggaagcttaaaaagcagtccgtggtctgagttagatggactccagccagag
acaaagatcataaacgaaaagctcggcaaaatcaactccaacggcttcttgaccatcaat
agccaaccatcagtcaacgcagcgaaatctgattctccagctattggatggggtggtcct
ggtggatacgtctaccagaaagcttacctagagttcttctgctcaagggataagctagac
acaattgtggagaaatccaaagcttttccttccatcacctacatggccgtgaacaaagca
gggaactgggtatcaaacgttggtgaagccgatgtgaacgcagttacttggggagtgttc
ccagccaaggagattattcaaccgacaatcgtggatccagccagtttcaaagtctggaaa
gacgaagccttcgagatttggtcaagaagctgggctaacttgtacccagaggatgaccct
tctagaaagttgctcgaggaggtgaaaaacagctacttcctggtgagcttagtggacaac
gactacatcaatggtgatatattctccgtctttgcttga

KEGG   Brassica napus (rape): 106391805Help
Entry
106391805         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 2-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106391805
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106391805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106391805
NCBI-ProteinID: XP_013687970
AA seq 595 aa AA seqDB search
MKVIDKIKSWTDEGKTTFSFEFFPPRTEDGVDNLFERMDRLVAYGPAFCDITWGAGGSTA
DLTLDIVSRMQNVVCVESMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGENK
FVQVEGGFGCALDLVNHIRSKYGDYFGVAVAGYPEAHPDVIGENGLASKEAYQSDLEYLK
KKVDAGADLIVTQLFFDTDMLLKFVNDCRQIGINCPIVPGIMPINNYKGFLRMIGFCKTK
IPAEVMAALEPIQDNEEAVKAYGIHLGTEMCKKILAHGIKSLHLYTLNMEKSALSILMNL
GMIEESKISRSLPWRRPANVFRIKEDVRPIFWANRPKSYISRTKAWENFPQGRWGDSRSA
SYGALTDHQFSRPRARDKKLQQEWVVPLKSVEDIHEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLVKVNSKGFLPINSQPSVNAERSDSSTVGWGGPGGYVYQKAYLEFFCSKDKLD
ALVEICKALPSITYIAMNKGETWVSNTSQSDVNAVTWGVFPAKEIIQPTIVDPSSFNVWK
DEAFETWSRNWANLYPEAADPSRNLLEEVKNSYYLVSLVENDYINGNIFKVFSDL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcgataagatcaagtcatggaccgatgaaggtaaaacaacgttctccttc
gagttcttcccaccgaggacggaggatggagtcgacaatctcttcgaacgtatggatcgt
ctcgtcgcttacggtcctgccttctgcgacatcacgtggggagctggtggatctacggca
gatctcacgctcgacattgtctcgaggatgcagaacgttgtctgcgtcgagagtatgatg
catctcacgtgcacaaacatgccggtggagaagatcgatcatgcgcttgagacgataaga
tctaatgggattcagaacgttcttgcgcttagaggtgatcctcctcatggtgagaacaag
tttgttcaggttgaaggagggtttggttgcgctttggatcttgtgaatcatattaggagc
aagtatggtgattactttggtgtcgccgttgctggttaccctgaggctcatcctgatgtc
attggtgaaaatggcctagcttcaaaggaagcttaccagagtgatcttgagtaccttaag
aagaaggttgatgctggagctgatctaatcgttactcagcttttctttgacactgatatg
ttactcaaatttgtgaatgactgtcggcaaattggtatcaactgccccattgttcctgga
atcatgcccattaataactacaaagggtttttgcgtatgattggtttttgcaagaccaag
ataccagctgaggtcatggctgcattggagcctatccaggataatgaagaagctgtgaaa
gcctatggtattcaccttggaacagagatgtgtaaaaagatcttggctcatgggattaag
tctcttcatctctacacattgaacatggagaaatcagctctttcaatattgatgaatctt
ggtatgattgaagagtccaaaatctctcgctctttaccatggagacgtcctgctaatgtt
ttccgtattaaggaagatgtgcgtcccattttctgggcaaaccgtccaaagagttatatt
tcaagaaccaaggcctgggaaaacttcccacaaggtcgatggggtgattcacgcagtgcc
tcatatggtgcactcactgatcatcagttctcacgtccacgagcacgtgacaagaagctt
caacaagaatgggttgtcccattaaaaagcgttgaagatattcatgagaaattcaaggag
ctctgtcttggaaacttaaagagcagtccatggtctgaactagacgggctccagccagag
acaaagatcataaacgagcagctggtgaaagtaaactccaaaggcttcttgcccatcaat
agccaaccatcagtcaacgctgagagatctgattcttcaaccgttggatggggtggtcct
ggtggatatgtataccaaaaagcttacctagagttcttttgctcaaaggacaagttagat
gcacttgttgagatatgcaaagctttgccatccataacttacatagctatgaacaaaggt
gaaacttgggtgtcaaacacttcacagtctgatgtgaatgctgttacttggggtgttttc
ccggctaaggagatcattcagccaaccattgttgatccttctagcttcaatgtctggaaa
gatgaagcgtttgagacttggtcaagaaactgggctaacttgtaccctgaagcagctgac
ccttctagaaacttgcttgaggaggtcaagaacagctactatttggtaagtttggtagag
aatgactacatcaatggtaacatattcaaagtcttttctgatctttga

KEGG   Brassica napus (rape): 106396447Help
Entry
106396447         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 2
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106396447
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106396447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106396447
NCBI-ProteinID: XP_013692292
AA seq 594 aa AA seqDB search
MKVIDKIQSLADEGKPAFSFEFFPPKTEDGVDNLFERMDRMVAYGPTFCDITWGAGGSTA
DLTLDIASRMQNVVCVESMMHLTCTNMPVEKIDHALETIRANGIQNVLALRGDPPHGHDK
FVKVEGGLGCALDLVNHVRGKYGDYFGITVAGYPEAHPDVIGENGLASDEAYQSDLEYLK
RKVDAGADLIVTQLFYDTDVFLKFVNDCRQIGIKCPIVPGIMPINNYKGFLRMTGFCKTK
IPAEVMAALEPIQDNEEAVKAYGIHLGTEMCRKILAHGTKSLHLYTLNMEKSALAILMNL
GMIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWEDFPQGRWGDSRSA
SYGALTDHQFSRPRSRDKKLQQEWAVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLVKINSKGFLTINSQPSVNAERSDSSTVGWGGPGGYVYQKAYLEFFCSKEKLD
AVVEKCKALPSITYIAVNKGENWVSNTAQSDVNAVTWGVFPAKEIIQPTIVDPASFKVWK
DEAFETWSRSWADLYPEADPSRNLLEEVKNSYYLVSLVENDYINGDIFSVFADL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatagacaagatccagtccctagccgacgaaggcaaaccagccttctccttc
gagttcttccctcccaaaaccgaagatggagtcgacaacctcttcgaacgtatggaccgt
atggtcgcctacggccccactttctgcgacatcacttggggagctggcgggtccactgct
gatctcaccctcgacatagcttccaggatgcagaacgttgtctgtgtggagagcatgatg
catctcacctgcactaacatgccggttgagaagatagaccacgcgcttgagacgattaga
gctaatgggattcagaacgtgcttgcgcttagaggtgatcctcctcatggtcatgataag
ttcgttaaggttgaaggagggcttggttgtgctttggatcttgtgaatcatgttagaggg
aagtatggtgattactttgggatcactgtcgctggttatcctgaggctcatcctgatgtt
attggtgagaatgggcttgcttctgatgaagcttaccagagtgatcttgagtacttgaag
agaaaggttgatgctggagctgatctgattgttactcagctgttctatgatactgatgtt
ttccttaagtttgtgaatgattgtcggcaaattgggattaagtgtcctattgttcctggg
atcatgcctattaataactacaaagggttcttgcgtatgactggtttttgtaagaccaag
ataccagctgaggttatggctgcattggagcctatccaggacaatgaggaagctgtgaaa
gcctatggtatccaccttggaacagagatgtgcagaaagatcttggctcatggaaccaag
tctcttcatctctacacattgaacatggagaaatcagctcttgctatattgatgaatctt
ggtatgattgatgagtccaaaatctctcgttctttaccgtggagacgcccagcaaatgtt
ttccgtactaaggaagatgtgcgccccattttctgggcaaaccgtccgaagagctacatt
tctagaaccaagggctgggaagactttccacaaggcaggtggggtgattcacgcagtgcc
tcatatggtgcactcactgatcatcagttctcacgtccacgatcacgtgacaagaagctt
caacaagaatgggctgtcccactgaaaagcgttgaagatattcaggagaaattcaaggag
ctgtgccttggaaacttgaaaagcagtccatggtctgaactggacggactccagccagag
acaaagatcataaacgagcagctggtgaaaattaactccaaaggcttcttgaccatcaat
agccaaccatcagtcaacgcagagagatctgattcctcaactgttggatggggtggtcct
ggtggatatgtataccaaaaggcttacctagagttcttctgctcaaaggagaagttagat
gcagttgttgaaaaatgcaaagctttgccgtctataacttacatagccgtcaacaaagga
gagaactgggtatccaacactgcccagtccgatgtgaacgctgttacttggggagttttc
ccggctaaggagatcattcaaccaaccattgtggatccggctagcttcaaagtgtggaaa
gatgaagcgtttgagacttggtcaagaagctgggctgacttgtaccctgaagctgaccct
tcaagaaacttgctcgaggaggtcaagaacagctactatttggtgagtttggttgagaat
gactacatcaacggtgacatattcagtgtctttgctgatctttga

KEGG   Brassica napus (rape): 106396491Help
Entry
106396491         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 2-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106396491
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106396491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106396491
NCBI-ProteinID: XP_013692344
AA seq 595 aa AA seqDB search
MKVIDKIQSLADEGKTAFSFEFFPPKTEDGVDNLFERMDRMVAYGPTFCDITWGAGGSTA
DLTLDIASRMQNVVCVESMMHLTCTNMPVEKIDHALETIRANGIQNVLALRGDPPHGHDK
FVKVEGGFGCALDLVNHVRGKYGDYFGITVAGYPEAHPDVIGENGLASDEAYQSDLEYLK
RKVDAGADLIVTQLFYDTDVFLKFVNDCRQIGIKCPIVPGIMPINNYKGFLRMTGFCKTK
IPAEVMAALEPIQDNEEAVKAYGIHLGTEMCRKILAHGTKSLHLYTLNMEKSALAILMNL
GMIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWEDFPQGRWGDSRSA
SYGALTDHQFSRPRARDKKLQQEWVVPLKSVEDIQERFRELCLGNLKSSPWSELDGLQPE
TKIINEQLVKLNSKGCLTINSQPSVNAERSDSSTVGWGGPGGYVYQKAYLEFFCSKEKLD
AIVEKCKALPSITYIAVNKGDNWVSNTAQSDVNAVTWGVFPAKEIIQPTIVDPASFKVWK
DEAFETWSRSWANLYPEAADPSRNLLEEVKNSYYLVSLVENDYINGDIFSVFVDL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatagacaagatccagtccctagccgacgaaggcaaaacagccttctccttc
gagttcttccctcccaaaaccgaagatggagtcgacaacctcttcgagcgtatggaccgt
atggtcgcctacggccccactttctgcgacatcacttggggagctggcggatctactgct
gatctcaccctcgacatagcttccaggatgcagaacgttgtctgcgtggagagcatgatg
catctcacttgtactaacatgcctgtggagaagattgaccacgcgcttgagacgattaga
gctaatgggattcagaacgtgcttgcgcttagaggtgatcctcctcatggtcatgataag
tttgttaaggttgaaggagggtttggttgtgcgttggatcttgtgaatcatgttaggggg
aagtatggtgattactttgggatcactgttgctggttatcctgaggctcatcctgatgtt
attggtgagaatgggcttgcgtctgatgaagcttaccagagtgatcttgagtacttgaag
agaaaggttgatgctggagctgatctgattgttactcagctcttttatgatactgatgtt
ttcctcaagtttgtgaatgactgtcggcaaattgggattaagtgtcccattgttcctgga
atcatgcctattaataactacaaggggttcttgcgtatgactggtttctgtaagaccaag
ataccagctgaggttatggctgccttggagcctatccaggataatgaagaagctgtgaaa
gcctatggtatccaccttggaacagagatgtgcagaaagatcttggctcatggaaccaag
tctcttcatctctacacattgaacatggagaaatcagctcttgcaatattgatgaatctt
ggtatgattgatgagtctaaaatctctcgttctttaccatggagacgcccagcaaatgtt
ttccgtactaaggaagatgtgcgccccattttctgggcaaaccgtccgaagagctacatt
tctagaaccaagggctgggaagacttcccacaaggcaggtggggtgattcacgcagtgcc
tcatatggtgcactcactgatcatcagttctcgcgtccacgagcacgtgacaagaagctt
caacaagaatgggttgtcccattgaaaagcgttgaagatattcaggagagattcagggag
ctgtgccttggaaacttaaaaagcagtccatggtctgaactggacggactccaaccagag
acaaagatcataaacgagcagctggtgaaactcaactccaaaggctgcttgaccatcaat
agccaaccatcagtcaacgcagagagatctgattcctcaactgttggatggggaggtcct
ggtgggtatgtataccaaaaggcttacctagagttcttctgctcaaaggagaagttagat
gcaatcgttgagaaatgcaaagctttgccatctataacttacatagccgtcaacaaagga
gacaactgggtatcaaacactgcacaatccgatgtgaacgctgttacttggggtgttttc
ccggctaaggagatcattcaaccaaccattgtggatccggctagcttcaaagtgtggaaa
gatgaagcgtttgagacttggtcaagaagctgggctaacttgtaccctgaagctgctgac
ccttcaagaaacttgctcgaggaggtcaagaacagctactatttggtgagtttggttgag
aatgactacatcaacggtgacatattcagtgtctttgttgatctttga

KEGG   Brassica napus (rape): 106405655Help
Entry
106405655         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106405655
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106405655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106405655
NCBI-ProteinID: XP_013701632
AA seq 592 aa AA seqDB search
MKVVDKIKSVTEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPSFCDITWGAGGSTA
DLTLEIASRMQNAICVETMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGQDK
FVQVEGGFACALDLVNHIRSKYGDYFGITVAGYPEAHPDVIEANGLATPESYQSDLAYLK
RKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNEEAVKAYGIHFATEMCKKILAHGITTLHIYTLNVDKSAIGILMNL
GLIDESKITRSLPWRPPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPQGRWGDSRSA
SYSTLSDYQFMRPRARDKKLQQEWVVPLKGIEDVQEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLGKINSHGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLD
TLVEKSKAFPSITFMAVNKAENWVSNIGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYYLVSLVDNDYINGDIFSVFA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgtcgacaagatcaaatccgtgacggagcaaggccaaaccgccttctccttc
gagttcttccctccgaagaccgaagatggagtcgagaatctcttcgagcggatggatcgg
ctggtctcgtacggccccagcttctgcgacatcacctggggcgcgggaggatccaccgcg
gatctcaccctcgagatcgcgtcgaggatgcagaacgcgatctgcgtggagacgatgatg
catctcacttgcaccaacatgccggtggagaagatcgaccacgcgctcgagacgatcaga
tccaacgggattcagaatgtgcttgcgcttagaggagatccgcctcacgggcaggataag
ttcgttcaggtggagggagggtttgcttgtgctttggatctggtgaatcatattaggagc
aagtatggtgattactttgggattacggttgctggctaccctgaggctcatccggatgtg
attgaagctaatggacttgctactcctgagtcttatcagagtgatcttgcttacctgaag
agaaaggttgatgctggagcggatctgattgtgactcagctgttctatgatactgatata
ttcctcaagtttgtgaatgactgtcggcaaattgggattaactgtcctattgttcctggg
attatgcccatttccaactacaaggggttcttgcgtatggctggtttctgcaagaccaag
atacctgctgagctcactgctgccttggagcctatcaaggataatgaagaagctgtgaag
gcctatggtattcactttgcgaccgagatgtgcaaaaagattttggcccatggaatcact
acccttcatatctacacacttaacgtggacaaatcagctattggaatattaatgaacctt
ggtctgattgatgagtctaaaatcactcgttctttaccttggagaccccctgcaaatgtt
ttccgtaccaaggaagatgttcgccccattttctgggcaaaccgtccaaagagctacata
tctaggacaaagggctggaatgacttcccacagggacgttggggtgattcacgcagtgca
tcatatagtacactttcggattatcagttcatgcgcccacgagcacgtgacaagaagctt
cagcaagaatgggttgtcccattgaaaggcattgaagatgttcaagagaaattcaaagag
ctctgtcttggaaacttaaaaagcagtccttggtctgagttagatggtctccagccagaa
acaaagatcataaacgagcaactcggaaaaataaactcccacggcttcctgaccatcaat
agccaaccatcagtcaacgcagccaaatccgattccccagctattggatggggtggtcct
ggtggttacgtctaccagaaagcttaccttgagtttttctgctcaaaggataagttagac
acacttgtggagaaatccaaagcttttccttctatcaccttcatggctgtgaacaaagca
gagaactgggtatcaaacatcggtgaatccgatgtgaatgcagttacttggggagtgttc
ccagctaaggaggttatccaaccgacaattgttgatccagcaagtttcaaagtctggaaa
gacgaagcctttgagatttggtcaagaagctgggctaacttgtacccagaagatgaccct
tctagaaagttgctcgaggaggtgaagaacagctactatttggtaagcttagtggacaac
gattacatcaacggtgatatattctccgtctttgcttga

KEGG   Brassica napus (rape): 106414932Help
Entry
106414932         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106414932
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106414932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106414932
NCBI-ProteinID: XP_013710969
AA seq 592 aa AA seqDB search
MKVVDKIKSATEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPSFCDITWGAGGSTA
DLTLEIASRMQNAICVETMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGQDK
FVQVEGGFACALDLVNHIKSKYGDYFGITVAGYPEAHPDVIEADGLATPESYQSDLAYLK
KKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNEEAVKAFGIHFATEMCKKILAHGISTLHIYTLNMDKSAIGILMNL
GLIDESKITRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPQGRWGDSRSA
SYGTLSDYQFMRPRARDKKLQQEWVVPLKGIEDVQEKFKELCLGSLKSSPWSELDGLQPE
TKIINEKLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLD
TFMEKSKAFPSITYMAVNKAGNWVSNVGEADVNAVTWGVFPAKEIIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYFLVSLVDNDYINGDIFSIFA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagtcgacaagatcaaatccgcgacggagcaaggccaaaccgccttctccttc
gagttcttcccgccgaagaccgaagatggcgtcgagaatctcttcgaacggatggatcgt
ctggtctcgtacggaccttccttctgcgacatcacctggggcgccggaggatccaccgcg
gatctcacgctcgagatcgcctcgaggatgcagaacgcgatctgcgtggagacgatgatg
catctcacctgcaccaacatgccggtggagaagatcgaccacgcgctcgagacgattaga
tccaacgggattcagaatgtgctcgcgcttagaggggatccgcctcatgggcaggataag
ttcgttcaggtggaaggagggttcgcttgtgcgttggatctggtgaatcatattaagagc
aagtatggtgattactttgggatcactgttgctggttatcctgaggctcatccggatgtg
attgaagctgatggacttgctactcccgagtcttatcagagtgatcttgcttacctgaag
aaaaaggttgatgctggagcggatctgattgtgacgcagctgttctatgatactgatatt
ttcctcaagtttgtgaatgactgtcggcaaattgggattaattgtcccattgttcctggg
attatgcccatttctaactacaaggggttcttgcgtatggctggtttctgcaagaccaag
atacctgctgagctcactgctgcgttggagcctatcaaggacaatgaagaagctgttaag
gcctttggtattcactttgcaacagaaatgtgcaaaaagatcttggctcatggaatctct
acccttcatatctacacattgaacatggacaaatcagctattgggatattaatgaacctt
ggtctgattgatgagtcaaaaattactcgttctttaccttggagacgccctgcaaatgtt
ttccgaactaaagaagatgttcgtcctattttctgggcaaaccgtccaaagagctacata
tccagaacaaaaggctggaatgacttcccacagggacggtggggtgattcacgcagtgca
tcatatggtacactttccgattatcagttcatgcgcccacgagcacgtgacaagaagctt
caacaagaatgggtcgtcccattgaaaggcattgaagatgtgcaagagaaattcaaggag
ctctgccttggaagcctaaagagcagtccatggtctgagttagatggactccagccagag
acaaagatcattaacgagaagctcggcaaaatcaactccaacggcttcttgaccatcaat
agccaaccatcagtcaacgcagccaaatctgattccccagctattggatggggtggtcct
ggtggatacgtctaccagaaagcttacctagagttcttctgctcaaaggacaagttagac
acattcatggagaaatccaaagcttttccttccatcacctacatggccgtgaacaaagca
gggaactgggtatcaaacgttggcgaagccgatgtgaatgcagttacttggggagtgttc
ccagctaaggagattatccaaccgacaatcgtggatccagccagtttcaaagtctggaaa
gatgaagcctttgagatttggtcaagaagctgggctaacttgtacccagaggatgaccct
tctagaaagttgctcgaggaggtgaagaacagctacttcctggtgagcttagtggacaac
gactacatcaatggtgatatattttccatctttgcttga

KEGG   Brassica napus (rape): 106429264Help
Entry
106429264         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 2
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106429264
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106429264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106429264
NCBI-ProteinID: XP_013725459
UniProt: A0A078GZ08
AA seq 595 aa AA seqDB search
MKVIDKIKSWTDEGKTTFSFEFFPPRTEDGVDNLFERMDRLVAYGPAFCDITWGAGGSTA
DLTLDIVSRMQNVVCVESMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGENK
FVQVEGGFGCALDLVNHIRSKYGDYFGIAVAGYPEAHPDVIGENGLASKEAYQSDLEYLK
KKVDAGADLIVTQLFFDTDMLLKFVNDCRQIGIKCPIVPGIMPINNYKGFLRMIGFCKTK
IPAEVMAALEPIQDNEEAVKAYGIHLGTEMCKKILAHGIKSLHLYTLNMEKSALSILMNL
GMIEESKISRSLPWRRPANVFRIKEDVRPIFWANRPKSYISRTKAWENFPQGRWGDSRSA
SYGALTDHQFSRPRARDKKLQQEWVVPLKSVEDIHEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLVKVNSKGFLTINSQPSVNAERSDSSTVGWGGPGGYVYQKAYLEFFCSKDKLD
ALVEICKALPSITYIAMNKGETWVSNTSQSDVNAVTWGVFPAKEIIQPTIVDPSSFNVWK
DEAFETWSRNWANLYPEEADPSRNLLEDVKNSYYLVSLVENDYINGNIFKVFSDL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcgataagatcaagtcatggaccgacgaaggtaaaacaacgttctccttc
gagttcttcccaccgaggacggaggatggagtcgacaacctcttcgagcgtatggatcgt
ctcgtcgcttacggtcctgccttctgcgacatcacttggggagctggtggatctacggca
gatctcacgctcgacattgtctcgaggatgcagaacgttgtctgcgtcgagagtatgatg
catctgacgtgcactaacatgccggtggagaagatagatcatgcgcttgagacgataaga
tctaatgggattcagaacgttcttgcgcttagaggtgatcctcctcatggtgagaacaag
tttgttcaggttgaaggagggtttggttgcgctttggatcttgtgaatcatattaggagc
aagtatggtgattactttggtatcgctgttgctggttaccctgaggctcatcctgatgtc
attggtgaaaatggcctagcttcaaaggaagcttaccagagtgatcttgagtaccttaag
aagaaggttgatgctggagctgatctaatcgttactcagcttttctttgacactgatatg
ttactcaaatttgtgaatgactgtcggcaaatcggaatcaaatgtcccattgttcctgga
atcatgcctattaataactacaaagggttcttgcgtatgattggtttttgcaagaccaag
ataccagctgaggtcatggctgcactggagcctatccaggataatgaagaagctgtgaaa
gcctatggtatccaccttggtacagagatgtgtaaaaagatcttggctcatgggataaag
tctcttcatctctacacattgaacatggagaaatcagctctttcaatattgatgaatctt
ggtatgattgaagagtccaaaatctctcgttctttaccgtggagacgtcctgctaatgtt
ttccgtattaaggaagatgtgcgtcctattttctgggcaaaccgtccaaagagttacatt
tcaagaaccaaggcctgggaaaacttcccacaaggccggtggggtgattcacgcagtgcc
tcatatggtgcactcactgatcatcagttctcacgtccacgagcacgtgacaagaagctt
caacaagaatgggttgtcccattaaaaagcgtcgaagatattcatgagaaattcaaggag
ctttgccttggaaacttaaagagcagtccatggtctgaactggatggactccagccagag
acaaagatcataaacgagcagctggtgaaagtaaactccaaaggcttcttgaccatcaat
agccaaccatcagtcaacgctgagagatctgattcttcaaccgttggatggggtggtcct
ggtggatatgtataccaaaaggcttacctagagttcttctgctcaaaggacaagttagat
gcacttgttgagatatgcaaagctttgccatctataacttacatagctatgaacaaaggt
gaaacttgggtgtcaaacacttcacaatctgatgtgaatgctgttacttggggtgttttt
ccagctaaggagattattcaaccaaccattgttgacccttctagcttcaatgtctggaaa
gatgaagcgtttgagacttggtcaagaaactgggctaacttgtaccctgaagaagctgac
ccttccagaaacttgcttgaggatgtcaagaacagctactatttggtaagtttggtagag
aatgactacatcaatggtaacatattcaaagtcttttctgatctttga

KEGG   Brassica napus (rape): 111215188Help
Entry
111215188         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 2-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    111215188
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     111215188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 111215188
NCBI-ProteinID: XP_022574262
AA seq 595 aa AA seqDB search
MKVIDKIKSWTDEGKTTFSFEFFPPRTEDGVDNLFERMDRLVAYGPAFCDITWGAGGSTA
DLTLDIVSRMQNVVCVESMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGENK
FVQVEGGFGCALDLVNHIRSKYGDYFGVAVAGYPEAHPDVIGENGLASKEAYQSDLEYLK
KKVDAGADLIVTQLFFDTDMLLKFVNDCRQIGINCPIVPGIMPINNYKGFLRMIGFCKTK
IPAEVMAALEPIQDNEEAVKAYGIHLGTEMCKKILAHGIKSLHLYTLNMEKSALSILMNL
GMIEESKISRSLPWRRPANVFRIKEDVRPIFWANRPKSYISRTKAWENFPQGRWGDSRSA
SYGALTDHQFSRPRARDKKLQQEWVVPLKSVEDIHEKFKELCLGNLKSSPWSELDGLQPE
TKIINEQLVKVNSKGFLPINSQPSVNAERSDSSTVGWGGPGGYVYQKAYLEFFCSKDKLD
ALVEICKALPSITYIAMNKGETWVSNTSQSDVNAVTWGVFPAKEIIQPTIVDPSSFNVWK
DEAFETWSRNWANLYPEAADPSRNLLEEVKNSYYLVSLVENDYINGNIFKVFSDL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcgataagatcaagtcatggaccgatgaaggtaaaacaacgttctccttc
gagttcttcccaccgaggacggaggatggagtcgacaatctcttcgaacgtatggatcgt
ctcgtcgcttacggtcctgccttctgcgacatcacgtggggagctggtggatctacggca
gatctcacgctcgacattgtctcgaggatgcagaacgttgtctgcgtcgagagtatgatg
catctcacgtgcacaaacatgccggtggagaagatcgatcatgcgcttgagacgataaga
tctaatgggattcagaacgttcttgcgcttagaggtgatcctcctcatggtgagaacaag
tttgttcaggttgaaggagggtttggttgcgctttggatcttgtgaatcatattaggagc
aagtatggtgattactttggtgtcgccgttgctggttaccctgaggctcatcctgatgtc
attggtgaaaatggcctagcttcaaaggaagcttaccagagtgatcttgagtaccttaag
aagaaggttgatgctggagctgatctaatcgttactcagcttttctttgacactgatatg
ttactcaaatttgtgaatgactgtcggcaaattggtatcaactgccccattgttcctgga
atcatgcccattaataactacaaagggtttttgcgtatgattggtttttgcaagaccaag
ataccagctgaggtcatggctgcattggagcctatccaggataatgaagaagctgtgaaa
gcctatggtattcaccttggaacagagatgtgtaaaaagatcttggctcatgggattaag
tctcttcatctctacacattgaacatggagaaatcagctctttcaatattgatgaatctt
ggtatgattgaagagtccaaaatctctcgctctttaccatggagacgtcctgctaatgtt
ttccgtattaaggaagatgtgcgtcccattttctgggcaaaccgtccaaagagttatatt
tcaagaaccaaggcctgggaaaacttcccacaaggtcgatggggtgattcacgcagtgcc
tcatatggtgcactcactgatcatcagttctcacgtccacgagcacgtgacaagaagctt
caacaagaatgggttgtcccattaaaaagcgttgaagatattcatgagaaattcaaggag
ctctgtcttggaaacttaaagagcagtccatggtctgaactagacgggctccagccagag
acaaagatcataaacgagcagctggtgaaagtaaactccaaaggcttcttgcccatcaat
agccaaccatcagtcaacgctgagagatctgattcttcaaccgttggatggggtggtcct
ggtggatatgtataccaaaaagcttacctagagttcttttgctcaaaggacaagttagat
gcacttgttgagatatgcaaagctttgccatccataacttacatagctatgaacaaaggt
gaaacttgggtgtcaaacacttcacagtctgatgtgaatgctgttacttggggtgttttc
ccggctaaggagatcattcagccaaccattgttgatccttctagcttcaatgtctggaaa
gatgaagcgtttgagacttggtcaagaaactgggctaacttgtaccctgaagcagctgac
ccttctagaaacttgcttgaggaggtcaagaacagctactatttggtaagtttggtagag
aatgactacatcaatggtaacatattcaaagtcttttctgatctttga

DBGET integrated database retrieval system