KEGG   Brassica napus (rape): 106353488Help
Entry
106353488         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B-like
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106353488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106353488
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106353488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_5 LRR_8
Motif
Other DBs
NCBI-GeneID: 106353488
NCBI-ProteinID: XP_013648711
AA seq 359 aa AA seqDB search
MVSQEGPATLDRCFEKMKMEGVVISEWKDIPVELLMKILNLVDDRTVIIASGVCSGWRDA
ISFGLTRLSLSWCKKNLNSLVLSLAPKLVKLQTLVLRQDNPQLEDNAVEAIANHCHELQD
LDLSKSLKLTDHSLYSVARGCTNLTKLNLSGCTSFSDTALAYLTRFCKKLRVLNLCGCVE
AVSDNALQAIGENCNEMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVV
ALANKCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRSVKKGKFDEEGLRSLNISQ
CTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTAYPHPAH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtcaagaagggccagcaacacttgaccgatgctttgaaaagatgaagatggaa
ggagtcgtgatcagcgagtggaaagatatccctgtggagcttctcatgaagatccttaac
cttgttgatgatcggacggtcatcattgcttctggtgtttgcagtggctggagagatgct
atttcctttggtctcactcgtctctccctctcttggtgcaagaagaacctgaacagtttg
gttctgtctcttgctccaaaactcgtcaagcttcagacattagtattgagacaggacaac
cctcagcttgaggacaacgcagtggaagcaatagcgaatcactgtcacgagctacaagat
cttgacctaagcaaaagcttgaaactcactgaccattctctctattctgtggctcgcggt
tgcacaaacctcactaagctaaaccttagcggctgcacttccttcagcgacactgcttta
gcctatttgacaaggttttgcaagaagctcagagttctgaatctttgtggttgtgttgaa
gctgtttctgacaatgcattgcaggctattggggaaaactgcaatgagatgcagtcacta
aacttgggatggtgtgagaatataagtgatgatggagtcatgagcctagcttatggctgt
cctgatctaagaacccttgatctttgcggctgtgttctaattacagatgagagtgtggtg
gctttggcaaataagtgtgtacacttgaggtcattggggctatactactgcaggaacata
acggacagagccatgtactcgctggctcagagtggagtgaaaaacaagcacgagatgtgg
cggtcggttaagaaaggcaagttcgatgaagaaggactaagaagcctcaacattagccaa
tgcacttaccttacaccttcagcggttcaagctgtctgtgatacattccctgcgctccac
acttgctcaggcaggcattctctggttatgagtggttgtctgaatctaacatcagttcac
tgtgcctgtatcctccaggctcaccgcacccacaccgcttaccctcacccggctcattaa

KEGG   Brassica napus (rape): 106354633Help
Entry
106354633         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106354633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106354633
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106354633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_5 Sulfolobus_pRN LRR_8
Motif
Other DBs
NCBI-GeneID: 106354633
NCBI-ProteinID: XP_013650072
AA seq 355 aa AA seqDB search
MMSEGGSLNLCFKKMEGNMITEWKDIPVELLMRILNLVDDRTVIIASGVCSGWRDAISFG
LTHLSLSWCKKDMNSLVLSLAPKLVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLS
KSLKLTDRSLYSLARGCTNLTKLNLSGCTSFSDTALAYLTRFCRKLKVLNLCGCVEAVSD
NALQAIGENCSQMQSLNLGWCEKISDDGVMSLAYGCPDLRSLDLCGCVLITDESVVALAN
RCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRSVKKGKFDEEGLRNLNISQCTYL
TPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTALPHPAH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgaaggaggatcacttaacctatgcttcaagaagatggaaggaaacatgatc
accgagtggaaagatatccctgtggagcttctcatgagaatccttaacctcgttgatgat
cggacggtcatcattgcttctggtgtttgctctggctggagagatgctatctcctttggt
ctcacacatctctctctctcatggtgcaagaaagacatgaacagtttggttctgtctctc
gctccaaaactcgtcaagcttcagactctagtactaagacaagacaaacctcaactcgaa
gacaacgcagtcgaagccatagcgaatcactgccacgagctacaagatcttgaccttagc
aaaagcttgaaactcaccgaccgttccctctattctctagctcgcggttgcactaacctc
actaagctcaacctcagcggctgcacttcgttcagcgacaccgctcttgcgtacttgaca
aggttttgtcggaagcttaaagttctgaatctttgtggttgtgtggaagctgtatccgat
aatgctttgcaggctattggagagaactgtagtcagatgcagtcactaaacttgggatgg
tgtgagaagataagtgatgatggagtcatgagtttagcttatggctgtcctgatctgaga
agccttgatctctgtggctgtgtacttattacagatgagagtgtggtggctttggctaat
cgttgtgtacacttaaggtcattggggctatactattgcagaaacataaccgacagggcc
atgtactcgctggctcagagcggagtgaagaacaaacacgagatgtggagatcggttaag
aaaggaaaattcgacgaagaaggactaagaaaccttaacattagccaatgcacttacctc
acaccttcagcggttcaagcggtctgcgatacgttccctgcgctccacacttgttcaggc
aggcattcacttgtcatgagcggttgtctgaatttaacatcggttcactgtgcttgcatc
cttcaggctcaccgcacacacacagctttacctcacccggctcattga

KEGG   Brassica napus (rape): 106376596Help
Entry
106376596         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106376596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106376596
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106376596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_5 LRR_8
Motif
Other DBs
NCBI-GeneID: 106376596
NCBI-ProteinID: XP_013672140
AA seq 359 aa AA seqDB search
MVSEEGSATLDRCFEKMKMEGIVISEWKDIPVELLMKILNLVDDRTVIIASGVCSGWRDA
ISFGLTRLSLSWCKKNLNSLVLSLAPKLVKLQTLVLRQDNPQLEDNAVEAIANHCHELQD
LDLSKSLKLTDHSIYSLARGCTNLTKLNLSGCTSFSDTALAYLTRFCRKLKVLNLCGCVE
AVSDNALQAIGENCNEMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVV
ALANKCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKNEMWRSVKKGKFDEEGLRSLNISQ
CTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTALPHPAH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgaagaagggtcagcaacacttgaccgatgctttgaaaagatgaaaatggaa
ggtatcgtgatcagcgagtggaaagatatccctgtggagcttctcatgaagatccttaac
cttgttgatgatcggacggtcatcattgcttctggtgtttgcagtggctggagagatgct
atttcctttggtctcactcgtctctccctctcttggtgcaagaagaacctgaacagtttg
gttctgtctcttgctccaaaactcgtcaagcttcagacattagtattgagacaggacaac
cctcagcttgaggacaacgcagtggaagcaatagcgaatcactgtcacgagctacaagat
cttgacctaagcaaaagcttgaaactcaccgaccattctatctattctctggctcgcggt
tgcacaaacctcactaaactcaaccttagcggctgcacttcattcagcgacactgctttg
gcctatttgacaaggttttgcaggaagctcaaagttctgaatctttgtggttgtgtggaa
gctgtatctgacaatgcattgcaggctattggagaaaactgcaatgagatgcagtcacta
aacttgggatggtgtgagaatataagtgatgatggagtcatgagcctagcttatggctgt
cctgatctaagaacccttgatctttgcggctgtgttctaattacagatgagagtgttgtt
gctttggcaaataagtgtgtacacttgaggtcgttggggttatactattgcaggaacata
acagacagagcaatgtactcactggctcagagtggagtgaagaacaagaacgagatgtgg
cggtcggttaagaaaggaaaattcgatgaagaaggtctaagaagcctcaacattagccaa
tgcacttacctcacaccttcagcggttcaagctgtctgtgatacattccctgcgctccac
acttgctcaggcaggcattctctggtcatgagtggttgtctgaacctaacatcagttcac
tgtgcctgtatcctccaggctcaccgcacccacaccgctctccctcacccggctcattaa

KEGG   Brassica napus (rape): 106377228Help
Entry
106377228         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B-like isoform X1
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106377228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106377228
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106377228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_8 Sulfolobus_pRN LRR_5
Motif
Other DBs
NCBI-GeneID: 106377228
NCBI-ProteinID: XP_013672881
AA seq 355 aa AA seqDB search
MMSEGGSLNLCFEKMEGNMITEWKDIPVELLMRILNLVDDRTVIIASGVCSGWRDAISFG
LTRLSLSWCKKDMNSLVLSLAPKLVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLS
KSLKLTDHSLYSLARGCTNLTKLNLSGCTSFSDTALAYLTRICRKLKVLNLCGCVEAVSD
SALQAIGENCSQMQSLNLGWCEKISDDGVMSLAYGCPDLRSLDLCGCVLITDESVVALAN
RCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRSVKKGNFDEEGLRNLNISQCTYL
TPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTALPHPAH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgaaggaggatcacttaacctatgcttcgagaagatggaaggaaacatgatc
accgagtggaaagatatccctgtggagcttctcatgaggatccttaaccttgttgatgat
cggacggtcatcattgcttctggtgtttgctctggctggagagatgctatctccttcggt
ctcactcgtctctccctctcatggtgcaagaaagacatgaacagtttggttctgtctctc
gcaccaaaactcgtcaagcttcagactctagtactaagacaagacaaaccgcaactcgaa
gacaacgcagtggaagccatagcgaatcactgtcacgagttacaagatcttgacctaagc
aaaagcttgaaactcactgaccactccctctattctctagctcgcggctgcactaacctc
actaaactcaaccttagcggctgcacttcgttcagcgacactgctctcgcgtatttgaca
aggatttgtaggaagcttaaagttctgaatctttgtggttgtgtggaagctgtatctgac
agtgcattgcaggctattggagagaactgtagtcaaatgcagtcactaaacttgggatgg
tgtgagaagataagtgatgatggtgtcatgagtttagcttatggttgtcctgatcttaga
agccttgatctctgtggctgtgtacttattacagatgagagtgtggtggctttggctaat
cgttgtgtacacttaaggtcattggggctatactattgcagaaacataaccgacagggcc
atgtactcgctggctcagagcggagtgaagaacaaacacgagatgtggagatcggttaag
aaaggcaatttcgacgaagaaggactaagaaaccttaacattagccaatgcacttacctc
acaccttcagctgttcaagcggtttgtgatacgttccctgcgctccacacttgttcaggc
aggcattcacttgtcatgagcggttgtctgaacttaacatcggttcactgtgcttgcatc
cttcaggctcaccgcacacacacagctttacctcacccggctcattga

KEGG   Brassica napus (rape): 106386040Help
Entry
106386040         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106386040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106386040
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106386040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_5 Sulfolobus_pRN LRR_8
Motif
Other DBs
NCBI-GeneID: 106386040
NCBI-ProteinID: XP_013681392
AA seq 359 aa AA seqDB search
MVSEEGSATLDRCFEKMKMEGIVISEWKDIPVELLMKILNLVDDRTVIIASGVCSGWRDA
ISFGLTRLSLSWCKKNLNSLVLSLAPKLVKLQTLVLRQDNPQLEDNAVEAIANHCHELQD
LDLSKSLKLTDHSLYSLARGCTNLTKLNLSGCTSFSDTALAYLTRFCRKLKVLNLCGCVE
AVSDNALQAIGENCNEMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVV
ALANKCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRSVKKGKFDEEGLRSLNISQ
CTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTALPHPAH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgaagaagggtcagcaacacttgaccgatgctttgaaaagatgaagatggaa
ggcatcgtgatcagcgagtggaaagatatccctgtggagcttctcatgaagatccttaac
cttgttgatgatcggacggtcatcattgcttctggtgtttgcagtggctggagagatgct
atttcctttggtctcactcgtctctccctctcttggtgcaagaagaacctgaatagtttg
gttctgtctcttgctccaaaactcgtcaagcttcagacattagtattgagacaggacaac
ccccagcttgaggacaacgcagtggaagcaatagcgaatcactgtcacgagctacaagat
cttgacctaagcaaaagcttgaaactcaccgaccattctctctattctctggctcgcggt
tgcacaaacctcactaaactcaaccttagcggctgcacttcattcagcgacactgctttg
gcctatttgacaaggttttgcaggaagctcaaagttctgaatctttgtggttgtgtggaa
gctgtatctgacaatgcattgcaggctattggagaaaactgcaatgagatgcagtcacta
aacttgggatggtgtgagaatataagtgatgatggagtcatgagcctagcttatggctgt
cctgatctaagaacccttgatctttgcggctgtgttctaattacagatgagagtgttgtt
gctttggcaaataagtgtgtacacttgaggtcgttggggttatactattgcaggaacata
acagacagagcaatgtactcactggctcagagtggagtgaagaacaagcacgagatgtgg
cggtcggttaagaaaggaaaattcgatgaagaaggtctaagaagcctcaacattagccaa
tgcacttacctcacaccttcagcggttcaagctgtctgtgatacattccctgcgctccac
acttgctcaggcaggcattctctggtcatgagtggttgtctgaatctaacatcagttcac
tgtgcctgtatcctccaggctcaccgcacccacaccgctctccctcacccggctcattaa

KEGG   Brassica napus (rape): 106390223Help
Entry
106390223         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2A-like
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106390223
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106390223
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106390223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_8
Motif
Other DBs
NCBI-GeneID: 106390223
NCBI-ProteinID: XP_013686096
AA seq 362 aa AA seqDB search
MVMVVGETSMELDQCFQMMMMKMEGVSIKEWKDIPVELLLRILSLVDDRNVIAASGVCCG
WRDAISLGLTRLRLSWCNNNMNSLVLSLAPKFIKLQTLILRQDKPQLEDNAVEAIANHCH
ELQELDLSKSLRLTDRSLYALAHGCPNLTKLNLSACTSFSDKAIAYLTTFCRNLKVLNLC
GCVNAVSDYTLEAIGNNCNQMQSLNLGWWEKISDDGGMSLAYGCPDLRTLDLCGCVLITD
ESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKPGGQWKSSAKKSKFDEEGLR
SLNISQCTALTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRSVPHS
AH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggtagtaggagaaacatccatggagcttgaccagtgttttcagatgatgatg
atgaagatggaaggagtctcgatcaaagagtggaaagatatccctgttgagcttctcttg
agaatcctctctcttgttgatgatcggaatgtcattgctgcttctggtgtttgctgtggc
tggagagatgccatctcgcttggcctcactcgtctccggctctcttggtgcaacaacaac
atgaacagcttggttctttctcttgctccaaagtttataaagctgcagactttaatactg
cgccaagacaaacctcagctagaggacaatgcggtggaggccatagcaaatcactgccat
gagctgcaagagcttgatctcagcaaaagcctgagactcactgaccgttccctctacgca
cttgctcatggctgccctaacctcacaaaactcaaccttagcgcttgcacttcgttcagc
gacaaagctattgcgtatctgaccacgttctgcagaaacctgaaggttctaaatctttgt
ggatgtgttaacgctgtttctgactataccttggaggctattgggaacaactgcaatcag
atgcagtcactaaacttgggatggtgggagaagatcagtgatgatgggggtatgagttta
gcttatggctgtccagatctcaggaccctggacttgtgtggttgtgttctcattacagat
gagagtgtggtagctttagctgattggtgcgtccacttgagatcactggggctatactac
tgcagaaacataacggacagagccatgtactcgctagctcaaagcggggtgaagaacaaa
ccaggggggcaatggaaatcatcggccaagaagagcaaattcgacgaagaagggctgaga
agtctcaacataagccaatgcactgcacttacaccttcggctgttcaagcggtttgcgat
acgtttcctgctcttcacacgtgttcggggagacattcgcttgtgatgagcgggtgtttg
aacttgacgtctgtgcactgtgcttgtatccttcaggctcatcgctcggttcctcactct
gctcactga

KEGG   Brassica napus (rape): 106425880Help
Entry
106425880         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2A
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106425880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106425880
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106425880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_8
Motif
Other DBs
NCBI-GeneID: 106425880
NCBI-ProteinID: XP_013722056
AA seq 362 aa AA seqDB search
MVMVVGETSMELDQCFQMMMMKMEGVSIKEWKDIPVELLMRILSLVDDRNVIAASGVCCG
WRDAISLGLTRLRLSWCNNNMNNLVLSLAPKFVKLQTLILRQDKPQLEDNAVDAIANHCH
ELQELDLSKSLKLTDRSLYALAHGCPNLTKLNLSGCTSFSDKAIAYLTRSCRNLKVLNLC
GCVNAVSDYTLEAIGNNCNQMQSLNLGWCEKISDDGVMSLAYGCPDLRTLDLCGCVLITD
ESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKPGGQWKSSAKKSKFDEEGLR
SLNISQCTALTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRAVPHS
AH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggtagtaggagaaacatccatggagctagaccagtgttttcagatgatgatg
atgaagatggaaggagtctcgatcaaagagtggaaagacatccctgttgagcttcttatg
agaatcctctcccttgttgatgatcggaatgtcattgctgcttctggtgtttgctgtggt
tggagagatgccatctctcttggtctcactcgtctccgtctctcttggtgcaacaacaac
atgaacaacttggttctgtctcttgctcccaagtttgtaaagctgcaaactttaatactg
cgccaagacaaacctcagctagaggacaatgcggtggatgccatagcaaatcactgccat
gagctacaagagcttgatctcagcaaaagcttgaaactcactgaccgttccctctacgca
cttgctcatggttgccccaacctcacaaaactcaaccttagcggctgcacttcgttcagc
gacaaagctattgcgtatctgaccaggtcctgcagaaacctgaaagttctgaatctttgt
ggatgtgtcaacgctgtttctgactataccttggaggctattgggaacaactgcaaccag
atgcagtcactaaacttgggatggtgtgagaagatcagtgatgatggggttatgagttta
gcttatggctgtcctgatctcaggaccctggacttgtgtggttgtgttctcattacagat
gagagtgtggtagctttagctgattggtgcgtccacttgagatcactggggctatactac
tgcagaaacataacggacagagccatgtactcgctagctcaaagcggggtgaagaacaaa
ccaggggggcaatggaaatcatcagctaagaagagcaaattcgacgaagaaggcctgagg
agtctcaacataagccagtgcactgcacttacaccttcggctgttcaagcggtctgcgat
acgtttcctgctcttcacacgtgttcggggagacattcgcttgtgatgagcgggtgtttg
aacttgacgtctgtgcactgtgcttgtatccttcaggctcatcgcgcggttcctcactct
gctcactga

KEGG   Brassica napus (rape): 106440720Help
Entry
106440720         CDS       T04128                                 

Definition
(RefSeq) F-box protein SKP2B-like isoform X1
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Module
bna_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106440720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106440720
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106440720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box F-box-like LRR_8 Sulfolobus_pRN LRR_5
Motif
Other DBs
NCBI-GeneID: 106440720
NCBI-ProteinID: XP_013737908
AA seq 355 aa AA seqDB search
MMSEGGSLNLCFEKMEGNMITEWKDIPVELLMRILNLVDDRTVIIASGVCSGWRDAISFG
LTRLSLSWCKKDMNSLVLSLAPKLVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLS
KSLKLTDHSLYSLARGCTNLTKLNLSGCTSFSDTALAYLTRICRKLKVLNLCGCVEAVSD
SALQAIGENCSQMQSLNLGWCEKISDDGVMSLAYGCPDLRSLDLCGCVLITDESVVALAN
RCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRSVKKGNFDEEGLRNLNISQCTYL
TPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLTSVHCACILQAHRTHTALPHPAH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgaaggaggatcacttaacctatgcttcgagaagatggaaggaaacatgatc
accgagtggaaagatatccctgtggagcttctcatgaggatccttaaccttgttgatgat
cggacggtcatcattgcttctggtgtttgctctggctggagagatgctatctccttcggt
ctcactcgtctctccctctcatggtgcaagaaagacatgaacagtttggttctgtctctc
gcaccaaaactcgtcaagcttcagactctagtactaagacaagacaaaccgcaactcgaa
gacaacgcagtggaagccatagcgaatcactgtcacgagttacaagatcttgacctaagc
aaaagcttgaaactcactgaccactccctctattctctagctcgcggctgcactaacctc
actaaactcaaccttagcggctgcacttcgttcagcgacactgctctcgcgtatttgaca
aggatttgtaggaagcttaaagttctgaatctttgtggttgtgtggaagctgtatctgac
agtgcattgcaggctattggagagaactgtagtcaaatgcagtcactaaacttgggatgg
tgtgagaagataagtgatgatggtgtcatgagtttagcttatggttgtcctgatcttaga
agccttgatctctgtggctgtgtacttattacagatgagagtgtggtggctttggctaat
cgttgtgtacacttaaggtcattggggctatactattgcagaaacataaccgacagggcc
atgtactcgctggctcagagcggagtgaagaacaaacacgagatgtggagatcggttaag
aaaggcaatttcgacgaagaaggactaagaaaccttaacattagccaatgcacttacctc
acaccttcagctgttcaagcggtttgtgatacgttccctgcgctccacacttgttcaggc
aggcattcacttgtcatgagcggttgtctgaacttaacatcggttcactgtgcttgcatc
cttcaggctcaccgcacacacacagctttacctcacccggctcattga

DBGET integrated database retrieval system