KEGG   Brassica napus (rape): 106353652Help
Entry
106353652         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106353652
   00520 Amino sugar and nucleotide sugar metabolism
    106353652
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106353652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 106353652
NCBI-ProteinID: XP_013648877
AA seq 415 aa AA seqDB search
MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESANQFGELVADPDTNELLHYTEKPETF
VSDLVNCGVYVFTPDIFTAIRDVSSQRKDTAILRRVSSFEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETLDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKTAIVIGD
VYIHHSAKIHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggagctcaatggaggagaaagtggtggctgtgatcatggtcggtggtccaaccaaa
ggtactcgatttcgaccactgtccctgaatattccaaagcctctgtttcctattgccgga
caacccatggtgcatcatccaatctcagcttgtaaaaggattccaaacttggctcaaatc
tatcttgttggtttctatgaggaaagggagtttgcactttatgtctctgccatctccaat
gaactcaaagttcctgtcagatatctgagagaagacaagccacacggctcagctggtggg
ttgtatcactttagaaatctaatcatggaagatgacccgtctcatatcttcttgcttaat
tgtgatgtttgctgcagtttccccttgccagaaatgcttgaggctcataggaaatatggt
ggaattggaactcttcttgtgatcaaggtctctcctgaatcagcaaaccaatttggagaa
ctggttgcagatccagatactaatgaactgcttcattacaccgagaaacctgaaactttt
gtcagtgaccttgttaactgcggtgtttatgtatttacacctgacattttcactgctata
agagatgtttcctctcaaaggaaagatacagcaattctgagacgtgtttccagctttgaa
gctcttcaaccggcaacaaggatcccagcagattttgtaagactggatcaagacatcctt
tcacctctagctgggaagaagcagctatatacttatgagactttggatttctgggagcaa
atcaaatctcctggaatgtcgctgcggtgctcggaactctatctttcccagttccggttg
acttctccccaagtgttggccagtggtgatggaacaaagactgctatagtgattggcgat
gtttacatacatcattctgcaaaaatacacccaactgcaaagattggtcccaacgtctca
atctctgcaaatgcacgtgttgggcctggtgtcaggctcatcagctgtatcatccttgac
gacgttgagatcatggaaaatgcagtggtgactaacgcaattgttgggtggaaatcttct
atagggagatggtctcgtgtccaggctgagggagtctacaactccaaacttggagttact
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtattgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttataa

KEGG   Brassica napus (rape): 106354534Help
Entry
106354534         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106354534
   00520 Amino sugar and nucleotide sugar metabolism
    106354534
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106354534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106354534
NCBI-ProteinID: XP_013649945
AA seq 415 aa AA seqDB search
MVSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIRDVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVTGD
VFIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggtgagctcgatggatgaaaaagtggtggctgtgatcatggtcggtggtccaaccaaa
ggtactcgattccgaccattgtctctgaatattccaaagcctctgtttcctattgcggga
caaccaatggtgcatcatccaatttcagcgtgtaaaaggattcctaatttagctcaaatc
tatcttgtcggtttctatgaggaaagggagtttgcactttatgtctctgccatttccaat
gaactcaaagttcctgtcagatatctcagagaagacaagccacatggttcagctggtggt
ctgtatcactttagaaatctaatcatggaagatgacccgtctcatatcttcctgcttaac
tgtgatgtctgctgcagtttccccttgcctgaaatgctcgaggctcatcggaaatatggt
ggaattggaacacttcttgtaatcaaggtctctcctgaatcagccagccagtttggagaa
ctggttgcagatccagttactaatgagctgcttcactacaccgagaaacctgaaactttt
gtcagtgaccgtattaactgcggtgtttatgtatttacacctgacatttttactgccata
agagatgtttcttctcaaacgaaagatacagcaactttgagacgtgtttccagcgttgaa
gctcttcaaccggcaacaaggaactccacggattttgtaagactggatcaagacatcctt
tcacctctagctgggaagaaacagctatatacttacgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctttctcagttccggttg
acctcaccacaagtgctggctagtggagatggaacaaagagtgccatagtgactggtgat
gttttcatacatccttctgcaaaagtacacccaactgcaaagattggtcccaacgtctca
atctctgccaatgctcgtgttggacccggtgtcaggcttatcagctgtatcatccttgat
gacgttgagatcatggaaaatgcagtggtgactaacgcaattgttgggtggaaatcttct
atcgggagatggtcccgtgtccaggctgagggagtctacaactccaaactcggagttaca
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtatcgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttgtaa

KEGG   Brassica napus (rape): 106354535Help
Entry
106354535         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106354535
   00520 Amino sugar and nucleotide sugar metabolism
    106354535
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106354535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106354535
NCBI-ProteinID: XP_013649947
AA seq 415 aa AA seqDB search
MVSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIRDVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVTGD
VFIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSNVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggtgagctcgatggatgaaaaagtggtggctgtgatcatggtcggtggtccaaccaaa
ggtactcgattccgaccattgtctctgaatattccaaagcctctgtttcctattgcggga
caaccaatggtgcatcatccaatttcagcgtgtaaaaggattcctaatttagctcaaatc
tatcttgtcggtttctatgaggaaagggagtttgcactttatgtctctgccatttccaat
gaactcaaagttcctgtcagatatctcagagaagacaagccacatggttcagctggtggt
ctgtatcactttagaaatctaatcatggaagatgacccgtctcatatcttcctgcttaac
tgtgatgtctgctgcagtttccccttgcctgaaatgctcgaggctcatcggaaatatggt
ggaattggaacacttcttgtaatcaaggtctctcctgaatcagccagccagtttggagaa
ctggttgcagatccagttactaatgagctgcttcactacaccgagaaacctgaaactttt
gtcagtgaccgtattaactgcggtgtttatgtatttacacctgacatttttactgccata
agagatgtttcttctcaaacgaaagatacagcaactttgagacgtgtttccagcgttgaa
gctcttcaaccggcaacaaggaactccacggattttgtaagactggatcaagacatcctt
tcacctctagctgggaagaaacagctatatacttacgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctttctcagttccggttg
acctcaccacaagtgctggctagtggagatggaacaaagagtgccatagtgactggtgat
gttttcatacatccttctgcaaaagtacacccaactgcaaagattggtcccaacgtctca
atctctgccaatgctcgtgttggacccggtgtcaggcttatcagctgtatcatccttgat
gacgttgagatcatggaaaatgcagtggtgactaacgcaattgttgggtggaaatcttct
atcgggagatggtcccgtgtccaggctgagggagtctacaactccaaactcggagttaca
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtaacgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttgtaa

KEGG   Brassica napus (rape): 106376641Help
Entry
106376641         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106376641
   00520 Amino sugar and nucleotide sugar metabolism
    106376641
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106376641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 106376641
NCBI-ProteinID: XP_013672195
AA seq 415 aa AA seqDB search
MESSTEEKVVAVILVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQV
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDNPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPEIFTAIRDVSSQRNDTATLRRVSSYEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPHILASGDGTKSAIVIGD
VYIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctcaacggaggagaaagttgtggctgtgatcttggtcggtggtccgaccaaa
ggtactcgattccgaccattgtccctgaacattccaaagcctctgtttcccattgctgga
caaccaatggtgcatcaccctatctctgcttgtaaaaggattccaaacttagctcaagtc
tatcttgttggtttctatgaggaaagggagtttgcactttacgtctctgccatttccaat
gaactcaaagtccctgtcagatatctgagagaagacaagccacatggttctgctggtggg
ttgtatcactttagaaacctaatcatggaagataacccgtctcatatcttcctacttaac
tgtgatgtttgctgcagtttccccttgccagaaatgctcgaggctcataggaaatatggt
gggattggaactcttctagtcatcaaggtctctcctgaatcagcaagccaatttggagaa
ctggttgcagatccagttactaatgagctgcttcattacaccgagaaacccgaaaccttt
gtcagtgaccgtattaactgcggtgtttatgtattcacacctgaaatttttactgctata
agagatgtttcctctcaaaggaatgatacagcgactctgagacgtgtttccagctatgaa
gctcttcaaccggcaacaaggatcccggcagattttgtaagattggatcaagacatcctc
tcacctttagctgggaagaaacagctctatacttatgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctatcccagttccggtta
acctctccccacatattggctagtggtgatggaacaaagagtgccatagtgattggtgat
gtttacatacatccttctgcaaaagtacacccaactgcaaagattggtcccaacgtctca
atctctgcaaatgcccgtgttggaccgggtgtgaggcttatcagctgtatcattcttgac
gacgttgagatcatggaaaatgcagtggtgacaaatgctatcgtcggttggaaatcttca
atcgggagatggtcccgtgtccaggctgagggagtctacaattccaaacttggagttaca
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtattgttctt
ccaaataagactctcaacgttagtgttcaagacgagataatcttgtaa

KEGG   Brassica napus (rape): 106387245Help
Entry
106387245         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106387245
   00520 Amino sugar and nucleotide sugar metabolism
    106387245
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106387245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 106387245
NCBI-ProteinID: XP_013682516
AA seq 415 aa AA seqDB search
MGSAVEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPHLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYQFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESANQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIRDVSFQRKDTAILRRVSSFEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETLDFWEQIKSPGMSLRCSGLYLSQFRLTSPQVLASGDGTKSAIVIGD
VYIHPSAKIHPTAKIGPNVSISANARVGPGVRLISCIILDNVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgcagtggaggagaaagtggtggctgtgatcatggtcggtggtccaaccaaa
ggtactcgatttcgaccattgtccctgaatattccaaagcctctgtttcctattgctgga
caaccaatggtgcatcaccctatctcagcttgtaaaaggattccacacttggctcaaatc
tatcttgttggtttctatgaggaaagggagtttgcactttatgtctctgccatttccaat
gaactcaaagttcctgtcagatatctgcgagaagacaagccacatggttcagctggtggg
ttgtatcagttcagaaatctaatcatggaagatgacccgtctcatatcttcctgcttaac
tgtgatgtttgctgcagcttccccttgccagaaatgctcgaggctcataggaaatatggt
ggaattggaactcttcttgtgatcaaggtctctcctgaatcagcaaaccaatttggagaa
ctggttgcagatcctgttactaatgaactgcttcattacaccgagaaacccgaaactttt
gtcagtgaccgtattaactgcggtgtttatgtatttacacctgacattttcactgccata
agagatgtttcctttcaaaggaaagatacagcaattctgagacgtgtttccagctttgaa
gctcttcaaccggcaacaaggatcccagcagattttgtaagactggatcaagacatactt
tcacctctagctgggaagaagcagttatatacttacgagactttggatttctgggaacaa
atcaaatctcctgggatgtcgctgaggtgctcgggactctatctttctcagttccggttg
acatctccgcaagtgttggctagtggtgatggaacaaagagcgcaatagtgattggtgat
gtttacatacatccttctgcaaaaatacacccaactgcaaagattggtcccaacgtatca
atctctgcaaatgctcgtgttgggcctggtgtcaggctcatcagctgtatcatccttgac
aacgttgagatcatggaaaatgcagtggtgactaacgcaattgttgggtggaaatcttct
atagggagatggtcccgtgtccaggctgagggagtctacaactccaaactaggagttact
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtattgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttataa

KEGG   Brassica napus (rape): 106391556Help
Entry
106391556         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106391556
   00520 Amino sugar and nucleotide sugar metabolism
    106391556
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106391556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 DUF4954 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 106391556
NCBI-ProteinID: XP_013687684
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLRE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGKVEKFVEKPKLYVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKK
SPGKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGVRIKK
HACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNILKPEIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattcttgttggagggttcggtactcgcttgagaccattgactctaagt
ttcccaaagccgctcgttgattttgctaacaaacccatgatccttcatcagatagaggcg
ctcaaggcagttggagttgatgaagtggtgttagccatcaattaccagccagaggtgatg
cttaacttcttgaaggactttgaggcgaagctggaaatcaaaatcacttgctcacaggag
actgagcctatgggtactgctggtcctctggctttagctagagacaaattggttgatgga
tctggagagcctttctttgtgctcaacagtgatgtgatcagtgagtacccgctcagagaa
atgattgagtttcacaaagctcatggtggtgaagcctccattatggtcacaaaggttgat
gaaccgtcgaagtatggagttgtggtgatggaagaaacaacaggaaaggtagagaagttt
gtggagaagccaaagctgtatgtaggcaacaagatcaacgctgggatctaccttctaaac
ccatctgttctcgacaagattgagctaagaccaacctcaatagagaaagagaccttcccc
aagatagcagcagctcaagggctctatgcaatggtgctaccaggattctggatggacatt
ggacaacccaaagactacataacgggtctaagactctacttagactctctgaggaagaaa
tctccagggaagctaaccaccggtgcacacattgttgggaatgttttggtggatgaaacg
gctaagattggggaagggtgtttgataggaccggacgtggctattggtccggggtgcgtt
gttgagtcaggggtgaggctctcgcggtgcacggtgatgcgtggggtaaggatcaagaag
catgcgtgtgtctcgagtagtatcattgggtggcactcgacggtggggcagtgggctagg
attgagaatatgacgatacttggggaagatgttcatgtgggtgatgagatttatactaat
ggaggagttgttttgccacataaggagatcaaatccaacatcttgaagccagagatagtc
atgtga

KEGG   Brassica napus (rape): 106392587Help
Entry
106392587         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106392587
   00520 Amino sugar and nucleotide sugar metabolism
    106392587
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106392587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106392587
NCBI-ProteinID: XP_013688846
AA seq 224 aa AA seqDB search
MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMIIHQIEALKAVGVDEVVLTVNYQAEVM
LNFLKDAEANLKIKITCLRETESIGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFKE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGKVEKFVEKPKLYVGNKINAGIYLLN
PSVVDKIELRPNPTISTSFPNPTTFTFFSTISTFFPTISTFYKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattcttgttggagggttcgggactcggttaagaccattgactctcagt
ttaccaaagccgcttgttgattttgctaataaacccatgatcatccatcagatagaggct
cttaaggctgttggagttgatgaagtggttttgacagtcaattaccaagcagaggtgatg
cttaacttcttgaaggacgctgaggcaaatcttaaaatcaaaatcacttgcttacgggag
actgagtctataggtacggctggtcctctggcactagcgagagacaaactggttgacgga
tctggagaacctttctttgtccttaacagtgatgtgattagtgagtatccattcaaagaa
atgattgagtttcataaagctcatggtggggaagcctccataatggtgacaaaggttgat
gaaccgtcgaaatatggagttgtggtcatggaagaaactacaggaaaagtggagaagttt
gtcgaaaagccaaaactctatgtaggcaacaagatcaacgctgggatttatcttctgaac
ccgtctgttgttgacaagattgagctaagacccaatcccaccatctccacttctttcccc
aaccccaccactttcaccttcttttccaccatctccaccttctttcccaccatttccacc
ttctataaaaattaa

KEGG   Brassica napus (rape): 106396536Help
Entry
106396536         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106396536
   00520 Amino sugar and nucleotide sugar metabolism
    106396536
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106396536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 IspD DUF4954 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106396536
NCBI-ProteinID: XP_013692402
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAVGVDEVVLTVNYQAEVM
LNFLKDVEEKLEIKITCSRETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFKE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGKVEKFVEKPKLYVGNKINAGIYLLN
PSVVDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKN
CPAKLTTGPDIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGARIKK
HACISSSIIGWHSTVGQWARIENMTILGEDVHVRDEIYSNGGVVLPHKEIKSNILMPGIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattcttgttggagggttcgggactcggttaagaccattgactctcagt
ttaccaaagccgcttgttgattttgctaataaacccatgatccttcaccagatagaggct
cttaaggctgttggggttgatgaagtggttttgacagtcaattaccaggcagaggtgatg
cttaacttcttgaaggacgttgaggaaaagctcgagatcaaaatcacttgctcaagagag
actgagcctatgggtacggctggtcctctggctctagcgagagacaaactggttgacgga
tctggagaacctttctttgtcctcaacagtgatgtgattagtgagtacccattcaaagaa
atgattgagtttcataaagcccatggtggggaagcctccatcatggtgacaaaggttgat
gaaccttctaaatatggagttgtggtcatggaagaaactacaggaaaagtggaaaagttt
gtcgaaaagccaaaactctatgtaggtaacaagatcaacgctgggatttatcttttgaac
ccgtcggtagttgacaagattgaactacgaccaacctcaatcgagaaagagaccttcccc
aagattgcagcagctcaagggctctatgcaatggtactaccagggttttggatggacatt
ggtcaaccacgtgactacataacgggcctgagactctacttagactccctaagaaagaat
tgtcctgccaagttaaccactggtccagacattgttgggaatgttttggtggatgaaacc
gctaagattggagaaggctgtttgataggaccagatgtagccattggtccaggctgtgtt
gttgagtcaggggttaggctctcacgttgcacggtgatgcgtggggcacgcatcaagaag
catgcatgtatctcgagcagtatcatagggtggcactcaacggttggacagtgggctagg
attgagaacatgacgatccttggggaagatgttcatgtgagagatgagatatatagcaat
ggaggagttgttttgccacacaaggagatcaaatcaaacatcttgatgccagggatagtg
atgtga

KEGG   Brassica napus (rape): 106404456Help
Entry
106404456         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106404456
   00520 Amino sugar and nucleotide sugar metabolism
    106404456
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106404456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106404456
NCBI-ProteinID: XP_013700631
AA seq 415 aa AA seqDB search
MGSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIREVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETKDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVIGD
VFIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVISSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggagctcaatggatgagaaagtggttgctgtgatcatggtcggtggtccaaccaaa
ggtactcgattccgaccattgtccctgaatattccaaagcctctgtttcctatcgccgga
cagccaatggtgcatcatccaatttcagcgtgtaaaaggattccaaacttagctcaaatc
tatcttgttggtttctatgaggaaagggagtttgcactttatgtctctgccatctccaac
gaactcaaagttcctgtcagatatctgagagaagacaagccacatggttctgctggtggt
ctgtatcactttagaaatctaatcatggaagatgacccgtctcatatcttcctgcttaac
tgtgatgtttgctgcagtttccctttgcctgaaatgctcgaggctcatcggaaatatggt
ggaattggaacacttcttgtgatcaaggtctctcccgaatcagccagccagtttggagaa
ctggttgcggatccagttactaatgagctgcttcattacaccgagaaacctgaaactttt
gtcagtgaccgtattaactgcggtgtttatgtatttacacctgacatttttactgccata
agagaagtttcttctcaaacgaaagatacagcaactctgagacgtgtttccagcgttgaa
gctcttcaaccggcaacaaggaactccacggattttgtaagactggatcaagacatcctt
tcacctctagctgggaagaaacagctatatacttacgagactaaggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctttctcaattcaggttg
acctcaccacaagtgctggctagtggtgatggaacaaagagtgccatagtgattggtgat
gttttcatacatccttctgcaaaagtacacccaactgccaagattggtcccaacgtctca
atctctgcaaatgctcgtgttggaccgggtgtcaggcttatcagctgtatcatccttgat
gacgttgagatcatggaaaatgcagttgtgactaacgcaattgttgggtggaaatcttct
atcgggagatggtcacgtgtccaggctgagggagtctacaactccaaactcggagtcaca
attctcggagactcggttgcagttgaagacgaggttgtggtgatcagcagtatcgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttgtaa

KEGG   Brassica napus (rape): 106408948Help
Entry
106408948         CDS       T04128                                 

Definition
(RefSeq) probable mannose-1-phosphate guanylyltransferase 3 isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106408948
   00520 Amino sugar and nucleotide sugar metabolism
    106408948
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106408948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 106408948
NCBI-ProteinID: XP_013705090
AA seq 362 aa AA seqDB search
MYRKGTGMKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAI
NHQQPEVMLNFVEEYEKKLDMKITFSQETEPLGTAGPLALARDKLIHESGKPFFVLNSDV
ICEYPLLEMIEFHKNHGAEASIMVTKVDDPSKYGVVVMEKEAKARVESFVEKPKHFVGDK
INAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGFWMDIGQPKDYLTGQR
MYLNYLRKNAPGELLASSGDGLIGNVMADETAVIGERCLIGPDVVIGAGCVIESGVRLFG
CTVMRGVRIKEHACVSDSIVGWDSTVGSWARVADVTVLGKDVQVADAEVIQMSAKPEIIQ
KV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgaaagggaactggaatgaaggctcttattctagttggaggatttggaactcga
ttgagaccgcttacattcagcatgccaaaaccccttgttgattttggtaacaagcccatg
attttgcatcagattgaagcactaaaagctgctggagttactgaagttgtattagctatc
aaccaccaacaaccagaggtaatgttgaattttgtggaagaatacgagaagaagcttgat
atgaagatcaccttctcccaagaaaccgaacccctcgggacagcaggccctctcgccttg
gctcgtgataagctcatccacgaatcaggcaaacccttctttgtgctaaacagcgatgtt
atctgcgaatatccactcctggagatgatcgagttccacaagaatcacggcgctgaagct
tccatcatggtgaccaaagtagatgatccttcaaagtacggtgtggtggttatggagaaa
gaagcaaaagcaagagtcgaaagtttcgttgagaaaccaaaacattttgtcggggacaag
atcaacgctgggatatacctcttgaacccgtctgtgctcgacaggatcgagctcagacgg
acgtcgatagagaaagagatattccctaagatcgcttcggagaagaagctttacgccatg
gtgctaccaggtttttggatggacatcggtcagccgaaagattacttgacggggcagaga
atgtacctcaactatctgagaaagaatgcgccgggggagcttttagcgtcgtcgggagat
ggcctaatcgggaacgttatggcggatgagaccgcggttataggggaacgatgcttgata
ggacctgacgtggtgattggtgctggatgcgtgattgaatcgggtgtgaggttgtttggt
tgcactgtgatgagaggtgtgaggatcaaggagcatgcttgtgtgtctgatagtatcgtg
gggtgggactcgaccgttggaagttgggctcgcgtagctgacgtgacagttctcgggaaa
gatgttcaggtcgccgatgcagaggttatacaaatgtctgcgaagccagagatcatacaa
aaagtgtga

KEGG   Brassica napus (rape): 106420759Help
Entry
106420759         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106420759
   00520 Amino sugar and nucleotide sugar metabolism
    106420759
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106420759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 106420759
NCBI-ProteinID: XP_013717055
UniProt: A0A078JBH7
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETTGKVEKFVEKPKLFVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK
SPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGARIKK
HACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYTNGGVVLPHKEIKSNILKPEIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattctcgttggagggttcgggactcggttgagaccattgactctcagt
ttcccaaagccccttgttgacttcgccaacaaacccatgatccttcatcagatagaggcg
ctcaaggcagttggagttgatgaagttgttttggccatcaattaccaaccagaggtgatg
cttaacttcttgaaagactttgaggcaaagctcgaaatcaaaatcacttgctcacaagag
actgagcctatgggtacggctggtcctctggctctagctagagacaaactggttgacgga
tctggagagcccttttttgtccttaacagtgatgtgattagtgagtacccactcaaagag
atgattgaatttcacaaagctcacggtggggaagcctccattatggtgacaaaggttgat
gaaccgtccaagtatggagttgtggtcatggatgaaactacaggaaaagtggagaagttt
gtggaaaagccaaaactgtttgtaggcaacaagatcaacgctgggatataccttctgaac
ccatctgttctcgacaagatcgagctaagaccgacatcgatcgagaaagaaaccttcccc
aagattgcagcagctcaaggactctacgcgatggtgttaccaggattctggatggacatc
gggcaaccccgtgattacataacgggcctgagactctacttagactctctgagaaagaaa
tctcccgccaagctaaccactggtgcacacattgttgggaacgttctggtggatgaaacc
gctaagattggggaagggtgtttgataggtccagacgtggccattggtccaggctgcgtt
gttgagtcaggggtgaggctttcacggtgcacggtcatgcgtggggcgaggatcaagaaa
catgcgtgtatctcgagcagtatcatagggtggcactcgacggttgggcagtgggctagg
attgagaacatgacgatcttgggggaagatgttcatgtgtgtgatgagatatacaccaat
ggaggagttgttttgccacacaaggagatcaaatccaacatcttgaagccagagatagtt
atgtga

KEGG   Brassica napus (rape): 106435901Help
Entry
106435901         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106435901
   00520 Amino sugar and nucleotide sugar metabolism
    106435901
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106435901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Fucokinase DUF4954
Motif
Other DBs
NCBI-GeneID: 106435901
NCBI-ProteinID: XP_013732291
AA seq 409 aa AA seqDB search
MSEDKVVAVIMVGGPTKGTRFRPLSFNTPKPLIPLAGQPMIHHPISACKKISNLAQIFLI
GFYEEKEFALYVSSISNELKIPVRYLKEDKPHGSAGALYYFRDKIMEEKPSHVFLLNCDV
CCSFPLQDILDAQRRYGGIGTMLVIKVSAEAASQFGELIADPDTKELLHYTEKPETFVSD
LINCGVYVFTSDIFKAIEGVYNQMRETSSNYNHFQYATRSAPADFVRLDQDILSPLAGKK
QLYTYENKDFWEQIKTPGKSLKCSDLYLSQFRETSPHLLASGDGTNKKPMIVGDVYIHPS
VKLHPTAKIGPNVSISANVRVGPGVRLINCIILDDVEIKDNAVVINSIIGWKSSIGRWSR
VQASGDDNERLGITILGEAVTVEDEVAVIGSIVLQNKTLNASVQDDIIL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagacaaagtcgtcgccgtgatcatggtcggaggaccgaccaaaggaactcgt
tttcgcccattatcgttcaatacgccgaagccgctgattcctttggctggccagccaatg
attcatcatcctatttctgcttgcaaaaagatatcaaacctggctcagatttttctgatt
gggttttacgaggaaaaagagttcgctttgtatgtttcttccatttctaacgagctcaaa
atccccgtgcgatacttgaaagaagataagcctcatggttctgctggtgctctttattac
tttcgcgataaaatcatggaagaaaaaccgtcgcatgttttcctcctaaactgtgatgtt
tgctgttctttccctctccaagacattctcgatgcacagcgtcgatatggtgggattggg
actatgctagtaatcaaggtttctgcagaagcagcaagccaatttggagagttgatagct
gatcctgatactaaagaactcttgcactatacagagaaaccagagactttcgtgagtgac
ttgatcaactgtggtgtctatgtgtttacctcagatattttcaaagccattgaaggagta
tacaaccaaatgagagagacttctagcaattacaaccacttccagtatgctacaaggtct
gctcctgcagattttgtgaggctagatcaagatatattgtcaccacttgctggaaagaag
caactatacacctatgagaataaggatttttgggaacagatcaagactccagggaagtct
ttgaaatgctcggacttgtatctttctcagttccgcgaaacttctcctcatcttttggct
tcaggagatggtactaataagaaaccgatgattgttggtgatgtttacattcacccatcc
gtaaaactacatccaaccgctaagattggtccaaacgtgtcaatctcagcaaacgttcgt
gttggacctggtgtaaggcttataaactgcataatcttggatgatgttgaaatcaaggac
aatgctgttgttataaactcgatcattggttggaaatcttcgataggaagatggtcaaga
gttcaagctagtggagatgacaatgagaggcttgggattaccattcttggtgaggctgtg
acagtagaagatgaagttgctgtcataggaagcattgttcttcagaataagactctcaat
gccagtgttcaagacgacataatcttatga

KEGG   Brassica napus (rape): 106435902Help
Entry
106435902         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106435902
   00520 Amino sugar and nucleotide sugar metabolism
    106435902
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106435902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Fucokinase DUF4954
Motif
Other DBs
NCBI-GeneID: 106435902
NCBI-ProteinID: XP_013732292
AA seq 404 aa AA seqDB search
MSDTKFKIDGTPGTRFRPLSFNPPKPLIPLAGQPMIHHPISACKKISNLAQIFLIGFYEE
KEFALYVSSISNELKIPVRYLKEDKPHGSAGALYYFRDKIMEEKPSHVFLLNCDVCCSFP
LQDILDAQRRYGGIGTMLVIKVSAEAASQFGELIADPDTKELLHYTEKPETFVSDLINCG
VYVFTSDIFKAIEGVYNQMRETSSNYNHFQYATRSAPADFVRLDQDILSPLAGKKQLYTY
ENKDFWEQIKTPGKSLKCSDLYLSQFRETSPHLLASGDGTNKKPMIVGDVYIHPSVKLHP
TAKIGPNVSISANVRVGPGVRLINCIILDDVEIKDNAVVINSIIGWKSSIGRWSRVQASG
DDNERLGITILGEAVTVEDEVAVIGSIVLQNKTLNASVQDDIIL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatacaaaattcaaaattgacggtactcctggaactcgttttcgcccattatcg
ttcaatccgccgaagccgctgattcctttggctggccagccaatgattcatcatcctatt
tctgcttgcaaaaagatatcaaacctggctcagatttttctgattgggttttacgaggaa
aaagagttcgctttgtatgtttcttccatttctaacgagctcaaaatccccgtgcgatac
ttgaaagaagataagcctcatggttctgctggtgctctttattactttcgcgataaaatc
atggaagaaaaaccgtcgcatgttttcctcctaaactgtgatgtttgctgttctttccct
ctccaagacattctcgatgcacagcgtcgatatggtgggattgggactatgctagtaatc
aaggtttctgcagaagcagcaagccaatttggagagttgatagctgatcctgatactaaa
gaactcttgcactatacagagaaaccagagactttcgtgagtgacttgatcaactgtggt
gtctatgtgtttacctcagatattttcaaagccattgaaggagtatacaaccaaatgaga
gagacttctagcaattacaaccacttccagtatgctacaaggtctgctcctgcagatttt
gtgaggctagatcaagatatattgtcaccacttgctggaaagaagcaactatacacctat
gagaataaggatttttgggaacagatcaagactccagggaagtctttgaaatgctcggac
ttgtatctttctcagttccgcgaaacttctcctcatcttttggcttcaggagatggtact
aataagaaaccgatgattgttggtgatgtttacattcacccatccgtaaaactacatcca
accgctaagattggtccaaacgtgtcaatctcagcaaacgttcgtgttggacctggtgta
aggcttataaactgcataatcttggatgatgttgaaatcaaggacaatgctgttgttata
aactcgatcattggttggaaatcttcgataggaagatggtcaagagttcaagctagtgga
gatgacaatgagaggcttgggattaccattcttggtgaggctgtgacagtagaagatgaa
gttgctgtcataggaagcattgttcttcagaataagactctcaatgccagtgttcaagac
gacataatcttatga

KEGG   Brassica napus (rape): 106438071Help
Entry
106438071         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106438071
   00520 Amino sugar and nucleotide sugar metabolism
    106438071
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106438071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 106438071
NCBI-ProteinID: XP_013734577
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETSGKVEKFVEKPKLFVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK
SPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGARIKK
HACISSSIIGWHSTVGQWARIENMTILGEDVHVCDEIYTNGGVVLPHKEIKSNILKPEIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattcttgttggagggttcgggactcggttgagaccgttgactctcagt
ttcccaaagccccttgttgactttgccaacaaacccatgatccttcaccagatagaggcg
ctcaaggcagttggggttgatgaagtggttctggccatcaattaccagccagaggtgatg
cttaacttcttgaaagactttgaggcaaagctcgaaatcaaaatcacttgctcacaagag
actgagcctatgggtactgctggtccactggctctagctagagacaaacttgttgatgga
tctggagagcccttctttgtccttaacagtgatgtgattagtgagtatccactcaaagaa
atgattgagtttcacaaagctcacggtggggaagcctccattatggtgacaaaggtcgat
gaaccgtccaagtatggagttgtggtcatggatgaaacttcaggaaaagttgagaagttt
gtggaaaagccaaaactgtttgtaggtaacaaaatcaacgctgggatctaccttctgaac
ccatctgttctcgacaagatcgagctaagaccgacatcaatcgagaaagagaccttccct
aagattgcagcagctcaaggactctacgcgatggtgttaccaggattctggatggacatt
gggcaacctcgcgactacataacgggcctcagactctacttagactctctgagaaagaag
tcacccgccaagctaaccactggtgcacacattgttgggaacgttctggtggatgaaact
gctaagattggggaaggttgtttgataggaccagacgtggccattggtccaggctgcgtt
gttgagtcaggggttaggctttcacggtgcactgtcatgcgtggggcaaggatcaagaag
catgcgtgtatctcgagcagtatcatagggtggcattcgacggttgggcagtgggctagg
attgagaacatgacgatcttgggggaagatgttcatgtgtgtgatgagatatacaccaat
ggaggagttgttttgccacacaaggagatcaaatcaaacatcttgaagccagagatagtt
atgtga

KEGG   Brassica napus (rape): 106441093Help
Entry
106441093         CDS       T04128                                 

Definition
(RefSeq) probable mannose-1-phosphate guanylyltransferase 3 isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106441093
   00520 Amino sugar and nucleotide sugar metabolism
    106441093
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106441093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 106441093
NCBI-ProteinID: XP_013738327
UniProt: A0A078HP85
AA seq 354 aa AA seqDB search
MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMLLHQIEALKAAGVTEVVLAINHQQPEV
MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL
EMIEFHTNHGAEASIMVTKVDDPSKYGVVVMEEEARVERFVEKPKHFVGDKINAGIYLLN
PSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGFWMDIGQPKDYLTGQRMYLNYLRKN
APGKLLVSSGDDVVIGNVMADETAVIGERCLIGPDVVIGAGCVIEPGVRLFGCTVMRGVR
IKEHACVSDSIVGWDSTVGSWARVADVTVLGKDVQVADAEVLQMSAKPEIIQKV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcttattctagttggaggatttggaactcgattgagaccgcttacgttcagc
atgccaaaaccccttgttgattttggtaacaagcccatgcttttgcatcagattgaagca
ctaaaagctgctggtgttactgaagttgtattagctatcaaccaccaacaaccagaggtc
atgttgaattttgtgaaagaatatgagaagaagcttgatatgaagatcaccttctctcaa
gaaaccgaacccctcgggacagcagggcctctcgctttggctcgggacaagctcatcgac
gaatcaggcaaacccttctttgtgctaaacagcgatgttatctgcgaatatccactcctg
gagatgatcgagttccacacgaatcacggcgctgaagcttccatcatggtgaccaaagta
gatgatccttcaaagtacggtgtggtggttatggaggaggaagcgagagtcgaaaggttc
gtcgagaaaccaaaacattttgtgggggacaagatcaacgctgggatatacctcttgaac
ccgtctgtgctcgacaggatcgagctcagacggacgtcgatagagaaagagatattcccc
aagatcgcttcggagaagaagctctacgccatggtgctaccaggtttctggatggacatt
ggtcagccgaaagattacttgacagggcagagaatgtacctcaactatctgagaaagaat
gcgcctgggaagcttttagtgtcgtctggagatgacgtggtgatcgggaatgttatggcg
gatgaaaccgctgttataggagaacgatgcttgataggacctgacgtggtgattggtgca
ggatgcgtgattgaacctggtgtgaggttgtttggttgcactgtgatgagaggtgtgagg
atcaaggagcatgcttgtgtgtctgatagtatcgtggggtgggactcgaccgttggaagt
tgggctcgcgtagctgacgtgacagttctcgggaaagatgttcaggttgcggatgcagag
gttttacaaatgtctgcgaaaccagagatcatacagaaagtatga

KEGG   Brassica napus (rape): 106443843Help
Entry
106443843         CDS       T04128                                 

Definition
(RefSeq) probable mannose-1-phosphate guanylyltransferase 3
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106443843
   00520 Amino sugar and nucleotide sugar metabolism
    106443843
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106443843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep CTP_transf_3 Hexapep_2 IspD
Motif
Other DBs
NCBI-GeneID: 106443843
NCBI-ProteinID: XP_013740852
AA seq 356 aa AA seqDB search
MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV
MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL
EMIEFHKNHAAEASIIVTKVDDPSKYGVVVMEKEGEEESRVESFVEKPKHFVGDKINAGI
YLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGFWMDIGQPKDYLTGQRMYLRY
LRKNAPEELLASSGDHVIGNVIADETAVIGERCLIGPDVVIGPGCVIESGVRLFGCTVMR
GSRIKEHACVSDSIVGWDSTVGSWARVANITVLGKDVRVADAEVYSSGASIQEQII
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcttattctagttggaggattcggaactcgattgagaccgcttacattcagc
attccaaaacccctagttgattttggaaacaagcccatgattttgcatcagattgaagct
ctaaaagctgctggagttactgaagttgtattagctatcaaccaccaacaaccagaggtg
atgttaaattttgtgaaagaatatgagaaaaagctagagatgaagatcaccttttctcaa
gaaaccgaacccctcgggacagcagggcctctcgctttggctcgtgacaagcttatcgat
gaatcaggcaaacccttttttgtgctgaacagtgacgttatctgcgaatatccattgctg
gagatgatcgagtttcacaagaatcacgccgctgaagcttcaatcattgtgaccaaagta
gacgatccttctaagtacggtgtggtggttatggagaaggaaggtgaagaagaatcaaga
gttgaaagtttcgttgagaaaccaaaacattttgttggggacaagatcaacgctgggata
tacctcttgaacccatctgtgctcgacaggatcgagctgagacggacatcgatagagaaa
gagatattccctaagatagcgtcagagaagaagctttacgccatggtgctacccggtttt
tggatggacattggtcagccaaaagattacttaacagggcagagaatgtatctccgctat
ctaagaaagaatgcaccagaggagcttttagcgtcgtccggagatcacgtgatcgggaat
gttattgcggatgagaccgcggttataggggaacgatgcttgataggacctgatgtggtg
attggtccaggatgtgtgattgaatccggtgtgagattgtttggttgcactgttatgcgc
ggttctcggatcaaggaacatgcttgtgtgtctgatagtatcgtgggatgggattcaacc
gttggaagttgggctcgtgtagctaacataacggttcttggcaaagatgttcgtgtcgct
gatgcagaggtttatagcagcggggcttctatccaagaacaaatcatatga

KEGG   Brassica napus (rape): 106447459Help
Entry
106447459         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106447459
   00520 Amino sugar and nucleotide sugar metabolism
    106447459
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106447459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 106447459
NCBI-ProteinID: XP_022574127
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLRE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGKVEKFVEKPKLYVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKK
SPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGARIKK
HACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDEIYTNGGVVLPHKEIKSNILKPEIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattcttgttggagggttcggtactcgcttgagaccattgactctaagc
ttcccaaagccgctcgttgattttgctaacaaacccatgatccttcatcagatagaggcg
cttaaggcagttggagttgatgaggtggtgttggccatcaattaccagccagaggtgatg
cttaacttcttgaaggactttgaggcgaagctcgagatcaaaatcacttgctcacaggag
actgagcctatgggaactgctggtcctctggctctagcgagagacaagttgattgatggt
tctggagagcctttctttgtgctcaacagtgatgtgattagtgagtacccgctcagagaa
atgattgagtttcacaaagctcatggtggggaagcctccattatggtcacaaaggttgat
gaaccgtcgaagtatggagttgtggtgatggaagaaacaacaggaaaggttgaaaagttt
gtggagaagccaaagctgtatgtaggcaacaagatcaacgctgggatctaccttctaaac
ccctctgttcttgacaagattgagctaagaccaacgtcaatagagaaagagaccttcccc
aagatcgcagcagctcaagggctctatgcaatggtgctacctggattctggatggacatt
ggacaacccaaggactacataacaggcctaaggctctacttagactctctgaggaagaaa
tctccagcgaagttaaccaccggtgcacacattgttgggaatgttttggtggatgaaacc
gctaagattggggaagggtgtttgataggaccagatgtggctattggtccggggtgtgtt
gttgagtcaggggttaggctctcgcggtgcacggtgatgcgtggggcgaggatcaagaag
catgcgtgtgtctcgagtagtatcattgggtggcattcaacggtggggcagtgggcgagg
attgagaatatgacgatacttggggaagatgttcatgtgggtgatgagatttatactaat
ggtggagttgttttgccacataaggagatcaaatccaacatcttgaagccagagatagtg
atgtga

KEGG   Brassica napus (rape): 106454454Help
Entry
106454454         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106454454
   00520 Amino sugar and nucleotide sugar metabolism
    106454454
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106454454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Fucokinase DUF4954
Motif
Other DBs
NCBI-GeneID: 106454454
NCBI-ProteinID: XP_013752027
AA seq 434 aa AA seqDB search
MSEEKVVAVIMVGGPTKGTRFRPLSFNTPKPLIPLAGQPMIHHPISACKKIPNLAQIFLI
GFYEEREFALYVSSISNELRIPVRYLKEDKPHGSAGALYYFRDRIMEEKPSHVFLLNCDV
CCSFPLQDILDAHRRYGGIGTMLVIKVSAEAASQFGELIADSDTKELLHYTEKPETFVSD
LINCGVYVFTSDIFKAIEGVYNQMRETCEFSSLLAFLKRHALFFFDFILNLAASNYNHFQ
YATRSVPADFVRLDQDILSPLAGKKKLYTYENKDFWEQIKTPGKSLKCSDLYLSQFRETS
PHLLASGAGTNKKPMIVGDVYIHPSVKLHPTAKIGPNVSISANVRVGPGVRLINCIILDD
VEIKDNAVVINSIIGWKSSIGRWSRVQASGDDNERLGITILGEAVTVEDEVAVIGSIVLQ
NKTLNASVQDDIIL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagagaaagtcgtcgccgtgatcatggtcggaggaccgaccaaaggaactcgt
tttcgcccattatcgttcaatacgcccaagccgctgattcctttggctggccagcccatg
attcatcatcctatctctgcttgcaaaaagataccaaacctggctcagatttttctgatt
gggttttacgaggaaagagagttcgctttgtatgtttcttccatttctaacgagctcaga
atcccagtgcgatacttgaaagaagataagcctcatggttctgctggtgctctttattac
tttcgcgatagaatcatggaagagaaaccgtcgcatgttttcctcctaaactgtgatgtt
tgctgttctttccctctccaagacattctcgatgcacatcgtcgatatggtgggattggg
actatgctagtaatcaaggtttctgcagaagcagcaagccaatttggagagttgatagct
gattctgatactaaagaactcttgcattacacagagaaaccagagactttcgtgagtgac
ttgatcaactgtggtgtctatgtgtttacctcagatatcttcaaagccattgaaggagta
tacaaccaaatgagagagacgtgtgagttttcttcactattggcctttctcaagagacat
gctttgtttttttttgactttatactaaacttggcagctagcaactacaaccacttccag
tatgctacaaggtctgttcctgcagattttgtgaggctagatcaagatatattgtcaccg
cttgctggaaagaagaaactatacacatatgagaataaggatttttgggagcagataaag
actccagggaagtctttgaaatgctcggacttgtatctctctcagttccgcgaaacttct
cctcatcttttggcttcaggagctggtactaataagaaaccgatgattgttggtgatgtt
tacattcacccatccgtaaaactacatccaaccgctaagattggtccaaacgtgtcaatc
tcagcaaacgttcgtgttggacctggtgtaaggcttattaactgcataatcttggacgat
gttgaaatcaaggacaatgctgttgtaataaactcgatcattggttggaaatcttcgata
ggaagatggtcaagagttcaagctagtggagatgacaatgagaggcttgggattaccatt
cttggtgaggctgtgacagtagaagatgaagttgcagtcataggaagcattgttcttcag
aataagactctcaatgccagtgttcaagacgacataatcttatga

KEGG   Brassica napus (rape): 111206356Help
Entry
111206356         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111206356
   00520 Amino sugar and nucleotide sugar metabolism
    111206356
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     111206356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 111206356
NCBI-ProteinID: XP_022558728
AA seq 415 aa AA seqDB search
MESSTEEKVVAVILVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQV
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDNPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPEIFTAIRDVSSQRNDTATLRRVSSYEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPHILASGDGTKSAIVIGD
VYIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctcaacggaggagaaagttgtggctgtgatcttggtcggtggtccgaccaaa
ggtactcgattccgaccattgtccctgaacattccaaagcctctgtttcccattgctgga
caaccaatggtgcatcaccctatctctgcttgtaaaaggattccaaacttagctcaagtc
tatcttgttggtttctatgaggaaagggagtttgcactttacgtctctgccatttccaat
gaactcaaagtccctgtcagatatctgagagaagacaagccacatggttctgctggtggg
ttgtatcactttagaaacctaatcatggaagataacccgtctcatatcttcctacttaac
tgtgatgtttgctgcagtttccccttgccagaaatgctcgaggctcataggaaatatggt
gggattggaactcttctagtcatcaaggtctctcctgaatcagcaagccaatttggagaa
ctggttgcagatccagttactaatgagctgcttcattacaccgagaaacccgaaaccttt
gtcagtgaccgtattaactgcggtgtttatgtattcacacctgaaatttttactgctata
agagatgtttcctctcaaaggaatgatacagcgactctgagacgtgtttccagctatgaa
gctcttcaaccggcaacaaggatcccggcagattttgtaagattggatcaagacatcctc
tcacctttagctgggaagaaacagctctatacttatgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctatcccagttccggtta
acctctccccacatattggctagtggtgatggaacaaagagtgccatagtgattggtgat
gtttacatacatccttctgcaaaagtacacccaactgcaaagattggtcccaacgtctca
atctctgcaaatgcccgtgttggaccgggtgtgaggcttatcagctgtatcattcttgac
gacgttgagatcatggaaaatgcagtggtgacaaatgctatcgtcggttggaaatcttca
atcgggagatggtcccgtgtccaggctgagggagtctacaattccaaacttggagttaca
attctcggagactcggttgcagttgaagacgaggttgtggtgaccagcagtattgttctt
ccaaataagactctcaacgttagtgttcaagacgagataatcttgtaa

KEGG   Brassica napus (rape): 111212018Help
Entry
111212018         CDS       T04128                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
bna_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111212018
   00520 Amino sugar and nucleotide sugar metabolism
    111212018
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     111212018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 111212018
NCBI-ProteinID: XP_022569106
AA seq 224 aa AA seqDB search
MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMIIHQIEALKAVGVDEVVLTVNYQAEVM
LNFLKDAEANLKIKITCLRETESIGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFKE
MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGKVEKFVEKPKLYVGNKINAGIYLLN
PSVVDKIELRPNPTISTSFPNPTTFTFFSTISTFFPTISTFYKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattcttgttggagggttcgggactcggttaagaccattgactctcagt
ttaccaaagccgcttgttgattttgctaataaacccatgatcatccatcagatagaggct
cttaaggctgttggagttgatgaagtggttttgacagtcaattaccaagcagaggtgatg
cttaacttcttgaaggacgctgaggcaaatcttaaaatcaaaatcacttgcttacgggag
actgagtctataggtacggctggtcctctggcactagcgagagacaaactggttgacgga
tctggagaacctttctttgtccttaacagtgatgtgattagtgagtatccattcaaagaa
atgattgagtttcataaagctcatggtggggaagcctccataatggtgacaaaggttgat
gaaccgtcgaaatatggagttgtggtcatggaagaaactacaggaaaagtggagaagttt
gtcgaaaagccaaaactctatgtaggcaacaagatcaacgctgggatttatcttctgaac
ccgtctgttgttgacaagattgagctaagacccaatcccaccatctccacttctttcccc
aaccccaccactttcaccttcttttccaccatctccaccttctttcccaccatttccacc
ttctataaaaattaa

DBGET integrated database retrieval system