KEGG   Brassica napus (rape): 106354929Help
Entry
106354929         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106354929
   00051 Fructose and mannose metabolism
    106354929
   00562 Inositol phosphate metabolism
    106354929
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106354929
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106354929
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106354929
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106354929
  Exosomal proteins of bladder cancer cells
   106354929
  Exosomal proteins of melanoma cells
   106354929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 106354929
NCBI-ProteinID: XP_013650422
AA seq 256 aa AA seqDB search
MLLRYDFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSILRP
DFHVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRALLNESNEFVGDKVAYAL
AQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSNWSNVVIAYEPVWAIGTGKVAS
PAQAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLK
PEFIDIIKAAEVKKSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttactgagatatgatttcttcgtcggaggcaactggaaatgcaacggaactgctgag
gaggtgaagaagattgtcaacactcttaacgaagctcaagttccttcccaggatgtcgtt
gaggttgtggttagccctccctatgtgttccttcctctggttaagagcatattgaggcct
gacttccatgttgcggcacagaattgctgggtcaagaaaggaggtgccttcactggtgaa
gttagtgctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaa
aggagggcactcctcaatgaatcaaacgagtttgttggagacaaggttgcctatgctctt
gctcaaggtttgaaagtgattgcttgtgtgggtgagactcttgagcagcgggaggcaggg
tcgaccatggatgttgtggctgcccagaccaaagctattgctgatcgagtgtcgaactgg
tcaaatgttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagc
cccgcccaagctcaggaagtacatgatgagctaaggaagtggcttgcaaagaacgtgagc
gctgatgtcgctgctacaacccgcatcatctatggaggatctgtcaatggtggtaactgc
aaggagctaggtggtcaagccgatgttgatggtttcttggtcggtggtgcttctctaaag
cctgagtttatcgacatcattaaggctgctgaggtgaagaaaagcgcttga

KEGG   Brassica napus (rape): 106357589Help
Entry
106357589         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106357589
   00051 Fructose and mannose metabolism
    106357589
   00562 Inositol phosphate metabolism
    106357589
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106357589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106357589
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106357589
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106357589
  Exosomal proteins of bladder cancer cells
   106357589
  Exosomal proteins of melanoma cells
   106357589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 106357589
NCBI-ProteinID: XP_013652725
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
HVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRALLNETNEFVGDKVAYALAQ
GLSVIACVGETLEQREAGSTMDVVAAQTKAIADRVSNWSKVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaggtg
aagaagattgtcaacactcttaacgaagctcaagttccttcccaggatgtcgttgaggtt
gtggttagccctccatatgtgtttcttcctctggttaagagcacattgaggtctgacttc
catgttgcggcacagaattgctgggtcaagaaaggaggtgccttcactggtgaagtcagt
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcacttctcaatgaaacaaacgagtttgttggagacaaggtagcctatgcccttgctcaa
ggtttgagtgtgattgcttgtgttggcgagactcttgagcagcgagaggctgggtcgacc
atggatgttgtggctgcccagactaaagctattgctgatcgagtgtcgaactggtcaaag
gttgtcatagcctatgaaccagtgtgggccattggaaccggaaaggttgcaagcccagcc
caagctcaggaagtgcatgatgagctgaggaaatggcttgcaaagaacgtgagcgctgat
gtcgctgctacaacccgcatcatttatggaggatccgttaatggtggtaactgcaaggag
ctgggtggtcaagccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcatcaaggctgctgaggtgaagaaaagcgcttaa

KEGG   Brassica napus (rape): 106357590Help
Entry
106357590         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106357590
   00051 Fructose and mannose metabolism
    106357590
   00562 Inositol phosphate metabolism
    106357590
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106357590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106357590
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106357590
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106357590
  Exosomal proteins of bladder cancer cells
   106357590
  Exosomal proteins of melanoma cells
   106357590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 106357590
NCBI-ProteinID: XP_013652726
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSILRPDF
HVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRALLNESNEFVGDKVAYALAQ
GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaggtg
aagaagattgtcaacactcttaacgaagctcaagttccttcccaggatgtcgttgaggtt
gtggttagccctccctatgtgttccttcctctggttaagagcatattgaggcctgacttc
catgttgcggcacagaattgctgggtcaagaaaggaggtgccttcactggtgaagttagt
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcactcctcaatgaatcaaacgagtttgttggagacaaggttgcctatgctcttgctcaa
ggtttgaaagtgattgcttgtgtgggtgagactcttgagcagcgggaggcagggtcgacc
atggatgttgtggctgcccagaccaaagctattgctgatcgagtgtcgaactggtcaaat
gttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagccccgcc
caagctcaggaagtacatgatgagctaaggaagtggcttgcaaagaacgtgagcgctgat
gtcgctgctacaacccgcatcatctatggaggatctgtcaatggtggtaactgcaaggag
ctaggtggtcaagccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggctgctgaggtgaagaaaagcgcttga

KEGG   Brassica napus (rape): 106368808Help
Entry
106368808         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, chloroplastic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106368808
   00051 Fructose and mannose metabolism
    106368808
   00562 Inositol phosphate metabolism
    106368808
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106368808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106368808
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106368808
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106368808
  Exosomal proteins of bladder cancer cells
   106368808
  Exosomal proteins of melanoma cells
   106368808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 106368808
NCBI-ProteinID: XP_013664312
UniProt: A0A078FL20
AA seq 320 aa AA seqDB search
MASSLTAQISCGTQPSAPSFSGLRRTCPKLDAAVSFSHHSFCNRVNSSIRLLSSSNRSPR
GVVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSL
TDRIEISGQNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDEFIGKKAAY
ALSEGLGVIACIGEKLEEREAGKTFDVCFDQLKAFADAVPSWDKVVVAYEPVWAIGTGKV
ASPQQAQEVHVAVRDWLKKNVSEEVASKTRIIYGGSVNGGNCAELAKEEDIDGFLVGGAS
LKGPEFATIVNSVTSKKVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctctcactgcccaaatatcctgtggcactcagccctctgccccttctttc
tccggcctccgccgcacttgtcccaagctcgacgccgccgtctccttctcccaccactcc
ttctgtaaccgcgttaactcctcaatccgtctcctttcctcctcgaaccggtcgccaaga
ggtgtcgtcgccatggccggatccggcaagtttttcgttggaggaaactggaaatgtaac
gggactaaagactccatcgccaagcttgtctccgacctcaacagtgcatccttggaagct
gatgtagatgttgttgtgtcgcctccctttgtgtacatcgaccaagtcaaatcctccttg
acagaccgtattgagatatccggtcagaactcttgggttgggaaaggtggtgccttcacc
ggtgaaatcagcgtggaacagctgaaagacattggatgcaagtgggtcattcttgggcat
tccgaaaggagacatgtcatcggtgaaaaagatgagtttattgggaagaaagctgcgtat
gcattgagtgagggtcttggagtaatagcttgtattggggagaagctagaagagagggaa
gcaggcaagacttttgatgtttgcttcgaccaattaaaagcctttgctgatgccgtgcct
agttgggacaaggtagtggttgcatacgagccagtatgggcaattggaactggtaaagtt
gcatctcctcagcaagcacaggaagttcatgtagctgtccgtgattggctcaagaagaat
gtctctgaggaagttgcttccaaaacaagaatcatatacggaggttctgtcaacggaggc
aactgtgcagagcttgctaaagaagaagacattgatggatttctcgtcggtggtgcctcc
ttgaaggggcctgagtttgcgaccattgtgaactctgtcacgtccaagaaagttgccgct
tga

KEGG   Brassica napus (rape): 106415572Help
Entry
106415572         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, chloroplastic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106415572
   00051 Fructose and mannose metabolism
    106415572
   00562 Inositol phosphate metabolism
    106415572
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106415572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106415572
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106415572
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106415572
  Exosomal proteins of bladder cancer cells
   106415572
  Exosomal proteins of melanoma cells
   106415572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 106415572
NCBI-ProteinID: XP_013711779
AA seq 320 aa AA seqDB search
MASSLTAQISCGTQPSAPSFSGLRRTCPKLDAAVSFSHHSFCNRVNSSIRLVSSSNRSPR
GVVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSL
TDRIEISGQNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDEFIGKKAAY
ALSEGLGVIACIGEKLEEREAGKTFDICFEQLKAFADAVPSWDKVVVAYEPVWAIGTGKV
ASPQQAQEVHVAVRDWLKKNVSEEVASKTRIIYGGSVNGGNCAELAKEEDIDGFLVGGAS
LKGPEFATIVNSATSKKVTA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctctcactgcccaaatatcatgtggcactcagccctccgccccttctttc
tccggcctccgccgcacctgtcccaagctcgacgccgccgtctccttctcccaccactcc
ttctgcaaccgcgttaactcctcaatccgtctcgtttcctcctcgaaccggtcgccaaga
ggcgtcgtcgccatggccggatccggcaagtttttcgttggaggaaactggaagtgtaac
gggactaaagactccatcgccaagcttgtctccgacctcaacagtgcatccttggaagct
gatgtagatgttgttgtgtcgcctccctttgtgtacatcgaccaagtcaaatcctccttg
acagaccgtattgagatatccggtcagaactcttgggttgggaaaggtggtgccttcacc
ggtgaaattagcgtggaacagctcaaagacattggatgcaagtgggtcattcttgggcat
tccgaaaggagacatgtcatcggtgaaaaagatgagtttattgggaagaaagctgcgtat
gcgttgagtgagggtctgggagtaatagcttgtatcggagagaagctagaagagagggaa
gcaggcaagacttttgatatctgcttcgagcaattgaaggcctttgctgatgctgtgcct
agctgggataaggtagtggttgcatacgagccagtatgggcaattggaactggtaaagtt
gcgtctcctcagcaagcacaggaagtccatgtagctgtccgcgattggctcaagaagaat
gtctctgaggaagttgcttccaaaacgagaatcatatacggaggttctgtcaatggaggc
aactgtgcagagcttgctaaagaagaagacattgatggatttctcgtcggtggtgcctcc
ttgaaggggcctgagtttgcgaccattgtgaactctgccacgtccaagaaagttaccgct
tga

KEGG   Brassica napus (rape): 106420738Help
Entry
106420738         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, chloroplastic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106420738
   00051 Fructose and mannose metabolism
    106420738
   00562 Inositol phosphate metabolism
    106420738
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106420738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106420738
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106420738
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106420738
  Exosomal proteins of bladder cancer cells
   106420738
  Exosomal proteins of melanoma cells
   106420738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 106420738
NCBI-ProteinID: XP_013717025
AA seq 312 aa AA seqDB search
MASSLTAAGTQPSAPSFSGLRRTCLKLEAAVSFSHRVNSSIRLVSSSQRSPRGVVAMAGS
GKFFVGGNWKCNGTKDSITKLVSDLNTATLEPDVDVVVSPPFVYIDQVKSSLTDRIEISG
QNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDEFIGKKAAYALSEGLGV
IACIGEKLEEREAGKTFDVCFDQLKAFADAVPSWDKVVVAYEPVWAIGTGKVASPQQAQE
VHVAVRDWLKKNVSEEVASKTRIIYGGSVNGGNCAELAKEEDIDGFLVGGASLKGPEFAT
IVNSVTSKKVAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctctcactgccgctggcactcagccctctgccccttctttctcgggcctc
cgccgcacttgccttaagctcgaagccgccgtctccttctcccaccgcgtcaactcatct
atccgtctcgtttcctcctcgcagcggtctcctagaggcgttgtcgccatggccggatcc
ggaaagtttttcgttggaggaaactggaagtgtaacgggactaaggactccatcaccaag
cttgtctctgacctcaacactgccaccttggaaccagatgttgatgtggttgtgtcgcct
ccatttgtgtacatcgaccaagtcaaatcttccttgacagaccgtattgaaatatctggt
cagaactcttgggttgggaaaggtggtgccttcaccggtgaaatcagcgtggaacagctc
aaagacattggctgcaagtgggtcattcttggccattccgaaaggagacatgtcatagga
gaaaaggatgagtttatcgggaagaaagctgcttacgcgttgagtgagggtcttggagta
atagcttgtatcggggagaagctggaagagagggaagcaggcaagacttttgatgtttgc
ttcgaccaattgaaggcctttgctgatgcggtgcctagctgggacaaggtagtggttgcg
tacgagccagtatgggcaattggaactggcaaagttgcatctcctcagcaagctcaggaa
gtccatgtagctgtccgtgattggctcaagaagaatgtctctgaagaagtcgcttccaaa
acgaggatcatatacggaggttctgtcaatggaggcaactgtgcagagcttgccaaagaa
gaagacattgatggttttcttgtcggcggtgcctccttgaagggacctgagtttgcgacc
attgtgaactcagtcacgtcaaagaaagttgctgcttga

KEGG   Brassica napus (rape): 106445356Help
Entry
106445356         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445356
   00051 Fructose and mannose metabolism
    106445356
   00562 Inositol phosphate metabolism
    106445356
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106445356
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106445356
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106445356
  Exosomal proteins of bladder cancer cells
   106445356
  Exosomal proteins of melanoma cells
   106445356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 106445356
NCBI-ProteinID: XP_013742342
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPMVKSILRPDF
YVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRALLNETNEFVGDKVAYALAQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAIADRVSNWSDVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaagtg
aagaagattgtcaacactcttaacgaagctcaagttccttcacaagacgtcgttgaggtt
gtggttagccctccatatgtgtttcttcctatggttaagagcatattgaggcctgacttc
tatgttgcggcacaaaattgctgggtcaagaaaggtggtgccttcactggtgaagtcagt
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcacttctcaatgaaacaaacgagtttgttggagacaaggttgcctatgctcttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgagcagcgagagtctggatcgacc
atggatgttgtggctgcccagactaaagctattgctgaccgggtgtcgaactggtcagat
gttgtcattgcatatgaaccagtgtgggccattggaaccggaaaggtcgctagcccagcc
caagctcaggaagtacatgatgagctgaggaagtggctcgcaaagaacgtgagcgctgat
gtcgctgctacaacccgcatcatctatggaggatctgtcaatggtggtaactgcaaggag
ctaggtggtcaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcatcaaggctgctgaggtgaagaaaagcgcttag

KEGG   Brassica napus (rape): 106445357Help
Entry
106445357         CDS       T04128                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00562  Inositol phosphate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00002  Glycolysis, core module involving three-carbon compounds
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445357
   00051 Fructose and mannose metabolism
    106445357
   00562 Inositol phosphate metabolism
    106445357
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106445357
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     106445357
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106445357
  Exosomal proteins of bladder cancer cells
   106445357
  Exosomal proteins of melanoma cells
   106445357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 106445357
NCBI-ProteinID: XP_013742343
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQEVVEVVVSPPYVFLPMVKSILRPDF
YVAAQNCWVKKGGAFTGEVSAEMLVNLNIPWVILGHSERRALLNETNEFVGDKVAYALAQ
GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSNWPNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggaaactggaaatgcaacggaactgctgaggaagtg
aagaagattgtcaacactcttaacgaagctcaagttccttcgcaagaagtcgttgaggtt
gtggttagccctccatatgtgtttcttcctatggttaagagcatattgaggcctgacttc
tatgttgcggcacaaaattgctgggtcaagaaaggtggtgccttcactggtgaagtcagt
gctgagatgcttgtgaacttgaacatcccatgggttatccttggtcactctgaaaggagg
gcactcctcaatgaaacaaacgagtttgttggagacaaggttgcctatgctcttgctcaa
ggtttgaaagtgattgcctgtgttggtgagactcttgagcagcgagaggcagggtcgacc
atggatgttgtggctgcccagactaaagctattgctgatcgagtgtcgaactggccaaat
gttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagcccagcc
caagctcaggaagtacatgatgagctaaggaagtggcttgcaaagaacgtgagcgctgat
gtcgctgctacaacccgcatcatctatggaggatctgtcaatggtggtaactgcaaggag
ctaggtggtcaagccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggctgctgaggtgaagaaaagcgcttga

DBGET integrated database retrieval system