KEGG   Brassica napus (rape): 106357261Help
Entry
106357261         CDS       T04128                                 

Definition
(RefSeq) protein STRICTOSIDINE SYNTHASE-LIKE 12
  KO
K01757  strictosidine synthase [EC:4.3.3.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00901  Indole alkaloid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106357261
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     106357261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Str_synth SGL Arylesterase NHL
Motif
Other DBs
NCBI-GeneID: 106357261
NCBI-ProteinID: XP_013652390
AA seq 326 aa AA seqDB search
MTSSVFLISLLLLSLSSAVFSDDASFQKLPIPGKRSGPEAFAFDTIGKAFFTGVSGGKIL
KYTADKGFEDFAEITTTSNSSWCNGIIGTALAGKCGRPAGIAFNPKTGDLYVADAPLGLH
VIPPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVVYFTSFSSKFSPSEVLIAVGLKDAS
GKLFKYDPATKAVTVLMEGISGGAGCAVSSDGSFVLVTEFIKSNIKRYWITGPKAGSTED
VTSSVSNPDNIKRIGATGNFWVASVKNKVVVPTDPSAVKIDYNGKVLQTISLKNEFGDTL
LSEANELDGKLYIGTLTGPFAGIMKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtctgtcttcttgatttctcttcttcttctttctctttcatcggccgttttc
tccgatgacgcatctttccagaaactcccaataccagggaagaggtctggccctgaagct
tttgccttcgataccatcggaaaagcttttttcaccggagtctccggtggtaaaatcctc
aagtatacagccgacaagggtttcgaagattttgccgagatcaccacgacttcgaattcg
tcatggtgcaatggaataattggaaccgctctggccgggaaatgtggccgacctgcgggg
atagccttcaaccccaaaacaggtgacctttacgtcgctgatgctccattgggtcttcac
gttatccctcccgccggagggttggccacaaagatcgccgatagtgtcgatggaaagccc
ttcaagttcttggacggtcttgacgttgatcccaccacaggcgtagtctacttcacttct
ttcagctcaaagttcagccccagcgaagtgttgatcgcagttggactaaaagacgcgagc
ggaaagctcttcaaatacgatccagcgactaaagcagtgacggtgttaatggaaggtata
agtggtggagctggttgcgccgtgagctcagatggttcgttcgtgctggttacggagttc
ataaagagtaacatcaagagatactggatcacaggacccaaagctggatcgacggaagat
gtcacaagttctgtctcgaaccctgacaacattaagaggatcggtgctactggaaacttt
tgggttgcttcggtcaagaacaaggtggtcgtgccaacggatccttcggctgtgaaaatc
gattataatggaaaagttcttcagaccatttctctcaagaatgagtttggggacactttg
cttagtgaagccaatgagttagacggcaaactttatattgggacacttactggacctttt
gctggaatcatgaaactttaa

DBGET integrated database retrieval system