KEGG   Brassica napus (rape): 106357578Help
Entry
106357578         CDS       T04128                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106357578
   00051 Fructose and mannose metabolism
    106357578
   00052 Galactose metabolism
    106357578
   00500 Starch and sucrose metabolism
    106357578
   00520 Amino sugar and nucleotide sugar metabolism
    106357578
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106357578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106357578
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106357578
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106357578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 106357578
NCBI-ProteinID: XP_013652713
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVCAASVYIVRRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKVLISYVDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGR
VVKQEAKEVSIPPHLMTSGSDELFNFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPV
KQTSLSSGTLIKWTKGFSIEDTVGQDVVGALVKAMERVGLDMNVTALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
LLDFDSLNPGEQILEKIISGMYLGEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPNM
SAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRKVVVSLCDIIACRGARLSAAGIYGILKK
LGRDAPKDGETQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASDSVEVIHSNDGSGV
GAALLAASHSQYLDDSQTS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttggtgcgacggtcgtgtgcgctgcggcggtttgcgcggcgtct
gtgtacatcgtgcggcggcggatgcaaagctccgggaaatgggcgcgtgtgatagagatc
ctgagggttctcgaggaggattgcgcgacgccaatcgggaaactgagacaagtggcggat
gcgatgacggttgagatgcacgcgggtctcgcttccgaaggtggaagcaagcttaaggtg
cttatcagctacgtcgataatcttccttctggggaagaacatggtttcttttatgcgctg
gacctaggaggaacgaacttccgtgtgatgcgtgtgcttcttggtggcaaacaaggccgt
gttgtcaaacaagaagccaaagaagtctctattcctcctcatttgatgaccagcggttcg
gatgagctgttcaattttatcgctgaagcgcttgcaaatttcgtggctacagaaggagag
gactttcatctcccagagggtagacaaagggagctaggtttcactttctcgtttccggtt
aagcagacatctttgtcttctggcactctcatcaagtggaccaaaggcttctccatcgaa
gatacagttggacaagatgtggttggtgcgcttgttaaagctatggaaagagttgggctt
gacatgaatgtcacagcccttgttaatgataccgttggaacacttgctggtggtagatac
tataaccctgatgttgtcgccgctgttattctaggcactggcacaaacgcagcttatgtt
gaacgtgcacatgccattcccaaatggcacggcttacttcccaaatctggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcacatcttccattgacggagtacgaccac
ttgctggatttcgatagtctgaatcctggtgaacagattcttgagaaaatcatttctggt
atgtatttgggagagatcttgcgtagagtccttctgaaaatggctgacgaggctgctttc
tttggcgactctgtcccacctaagctgagaataccattcataataaggacaccaaacatg
tctgctatgcacagcgacacttctccggatttgaaggttgttggaagcaagttaaaggac
atattggaggtccctaccacttctctgaagatgagaaaagttgtggtcagtctgtgtgac
atcatagcttgccgcggagctcgtctatcagctgcagggatctacggaatcctcaagaaa
ctaggaagagacgcaccgaaagacggagagacgcagaaatctgtgatagccatggacggt
ggactgtttgagcactacactcagttcagcgagtgtatggagagctcgttgaaagagttg
cttggagatgaagcatcagacagcgtggaggtgattcattcgaatgatggatctggcgtt
ggagctgcattactcgctgcctcgcactctcagtacctcgatgactctcaaacaagttaa

KEGG   Brassica napus (rape): 106359065Help
Entry
106359065         CDS       T04128                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106359065
   00051 Fructose and mannose metabolism
    106359065
   00052 Galactose metabolism
    106359065
   00500 Starch and sucrose metabolism
    106359065
   00520 Amino sugar and nucleotide sugar metabolism
    106359065
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106359065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106359065
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106359065
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106359065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF4179 UPF0016
Motif
Other DBs
NCBI-GeneID: 106359065
NCBI-ProteinID: XP_013654277
AA seq 503 aa AA seqDB search
MLIGERVKSCRENMARKEVVVAVTAATVTAVAAAVIIGQWVRRKERRRKQTQMILRKIAR
ECATPVSKLWAVADALVADMTAFLSATTAAGSCGSLNMLVSFAGALPSGDEKGLHYGVNL
RGKELLLLRGALGGNEEPISNVHKQEISIPADVLNGSFKELCDYISLELVKFIGMNPGEE
ADEVKNLGFTLTRYVEQIGPSSISAIQRKGLANDDDDTVLKEFVNDMNESLESHGLKIRM
NMALVDDTIGVLAGGRYYHKDTVAAVTLGMGTNAAYIEQAQEVLRWKPTIPNEPQEIVIS
TEWGDFRSCHLPVTEYDAALDAESLNPRSCVFEKMVAGGYLGEEIVRRVLLKMSQETALF
GDILPPKLTTPYTLSSPDMAAMHQDISEDRDIVNKKLKDVFGVMYSTLAAREVVIEVAER
AARVAGAGIVGMVKKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVV
IEHSHGGSGAGALFFAACGNVKT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcggagaacgggtaaaaagctgcagagagaacatggccaggaaagaggtggtg
gtggcggtcactgctgcgacggttactgcggttgcagccgctgtgataattggtcaatgg
gtgcggaggaaggagcggcggcggaaacaaacacagatgattttaagaaaaatcgctaga
gaatgcgccacgccggtttcgaagctatgggcggtggcggacgccttggtagccgacatg
actgcctttctttctgccaccacagccgccgggagttgcggctccctcaacatgctcgtt
tcattcgccggtgctctcccttcaggggatgagaagggactacattatggagttaacttg
cgaggcaaggaacttctactgttacgtggagctttaggaggtaacgaagaacctatttcc
aatgtacataaacaggagatttcaatccctgcggacgttttaaacggctctttcaaggag
ctgtgcgattacatatccttggagctagttaaattcattgggatgaatcctggggaagaa
gcagatgaagttaagaatctagggtttacgttaacacgctatgtcgaacagattgggcct
agttcaatctcggcgatacagaggaagggcttagcaaatgatgacgatgacacggttttg
aaggagtttgtgaatgatatgaatgaatcactggagagtcacggactgaagattcggatg
aacatggcgctggtggatgacacaattggagtgttggctggaggaaggtactatcataag
gacactgtggctgcagtcactttaggtatgggaacgaacgctgcttacatcgaacaagct
caagaggtcctgagatggaaacccacgataccaaacgagccacaagagattgttattagc
acggagtggggagatttcagatcatgtcatcttcctgtaactgaatatgatgctgctctt
gacgcagaaagcttgaatcctagaagctgcgtatttgagaagatggtggctggaggatac
ttaggggaggagatagtgagaagagtgttgctaaaaatgtcacaagaaactgctttattt
ggagatatactacctccaaaactgacaaccccttacactttaagttcgccagatatggcc
gcgatgcatcaagatatatcagaagatcgagatattgtaaacaaaaagctcaaggacgtt
ttcggggtcatgtattcaactcttgcggctagagaagtggtgattgaagtggccgaaaga
gctgcgcgtgtggcaggagcaggaatagttgggatggtaaagaagctgggaaggttagag
aaaaagatgagcattgtgatagttgaaggagggttgtatgatcattacagggtctttaga
aactatcttcatagcagtgtttgggaaatgctcggcgatgagttatcggaccatgtcgtc
attgagcattctcacggtggatctggtgccggagcccttttctttgctgcttgcggcaac
gttaaaacctaa

KEGG   Brassica napus (rape): 106368828Help
Entry
106368828         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106368828
   00051 Fructose and mannose metabolism
    106368828
   00052 Galactose metabolism
    106368828
   00500 Starch and sucrose metabolism
    106368828
   00520 Amino sugar and nucleotide sugar metabolism
    106368828
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106368828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106368828
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106368828
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106368828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106368828
NCBI-ProteinID: XP_022575819
AA seq 843 aa AA seqDB search
MGKVAVAFAAAAVLVSCSVAAVMVGRRIKSRAKWRAVVEILKEMEEACRTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVHHLPNGTEKGTYYALHLGGTYFRILRVHLGGERSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSMERFIEKEGKESNSQGVKRELAFTFSFPVK
HSSISSGVLIKWTKGFEISEMVGKDVAECLQGALNRRGLDIHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNPNDMGFEKIIAGLYLGDIVRRVILRMSQVSDIFGPTSPMLSEPYVLRTNSVSA
MHEDDTPELQEVARILKDLGVSEVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGR
DGSGGITSGRSRSEMRMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKA
MNSTSEVLFNFLAFSMERFIEKEGKESNSQGVKRELAFTFSFPVKHSSISSGVLIKWTKG
FEISEMVGKDVAECLQGALNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSN
ACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEK
IIAGLYLGDIVRRVILRMSQVSDIFGPTSPMLSEPYVLRTNSVSAMHEDDTPELQEVARI
LKDLGVSEVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGITSGRSRSEM
RMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIGSALLVAS
LQS
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggttgcggttgcgtttgcggcggctgcggttttagtgtcttgctccgtggcg
gcggtgatggtggggaggaggattaagagtcgggcgaaatggagggctgtggtggagatt
ttgaaggagatggaggaagcttgtcgtactccggtggggaggttgaggcaagtggtggat
gccatggcggtggagatgcacgctggcttggcttctgaaggtggctccaagcttaaaatg
cttctcactttcgtccatcatttgcccaatgggacggagaaaggaacttattatgcactt
caccttggaggcacttactttaggattttgagggttcatctgggtggtgaaaggtcttat
ctagatgttcaagacgttgaacgacaccccataccttcacatttgatgaatagcaccagc
gaggttcttttcaactttctcgccttttccatggaaaggtttatcgaaaaagaaggaaag
gaatctaattcacaaggtgtgaaaagggaacttgcgtttacgttttcgttccctgtcaaa
cattcttctatatcttcaggagttctaatcaaatggaccaaaggttttgagattagtgaa
atggttgggaaagatgtagctgaatgtctacaaggagcgctgaacagaagaggcctagat
atccatgttgcagctcttgtgaatgatactgtcggagccctgtcacttggatattatcat
gatccagatacagttgttgcggttgtatttggaacaggtagtaatgcatgttacttggaa
cgaactgatgccataatcaagtctcagggtctgcttaccacttctggaagcatggtagtc
aatatggagtggggtaatttttggtcctcacacctcccaagaacatcgtatgacattgac
ttggatgcagagagttcaaatccaaatgatatgggatttgagaagattatagcaggattg
tatctgggtgacattgttcgaagagtaatccttcgcatgtcacaagtctccgacatcttt
ggacccacctcgcccatgttatctgagccttacgttctaagaacaaattcagtctcagcc
atgcatgaagatgacacacctgagctgcaagaagtagctaggatcttgaaagacttgggg
gtatcagaagtaccattgaaggtgagaaaactcgtggtcaagatatgcgacgtggtgaca
cgaagagcagggaggctagcagcagcgggtattgcaggaatcttgaagaagattggccga
gatggcagcggaggaatcacgagcgggagaagcagaagcgaaatgcggatgcagaaaaga
acagttgttgcggtagaaggaggattgtacatgaattacaccatgtttagagaatacatg
gaagaggctttggtggagattttaggagaagaagtgagccaatacgtggtcgttaaagcc
atgaatagcaccagcgaggttcttttcaactttctcgccttttccatggaaaggtttatc
gaaaaagaaggaaaggaatctaattcacaaggtgtgaaaagggaacttgcgtttacgttt
tcgttccctgtcaaacattcttctatatcttcaggagttctaatcaaatggaccaaaggt
tttgagattagtgaaatggttgggaaagatgtagctgaatgtctacaaggagcgctgaac
agaagaggcctagatatccatgttgcagctcttgtgaatgatactgtcggagccctgtca
cttggatattatcatgatccagatacagttgttgcggttgtatttggaacaggtagtaat
gcatgttacttggaacgaactgatgccataatcaagtctcagggtctgcttaccacttct
ggaagcatggtagtcaatatggagtggggtaatttttggtcctcacacctcccaagaaca
tcgtatgacattgacttggatgcagagagttcaaatccaaatgatatgggatttgagaag
attatagcaggattgtatctgggtgacattgttcgaagagtaatccttcgcatgtcacaa
gtctccgacatctttggacccacctcgcccatgttatctgagccttacgttctaagaaca
aattcagtctcagccatgcatgaagatgacacacctgagctgcaagaagtagctaggatc
ttgaaagacttgggggtatcagaagtaccattgaaggtgagaaaactcgtggtcaagata
tgcgacgtggtgacacgaagagcagggaggctagcagcagcgggtattgcaggaatcttg
aagaagattggccgagatggcagcggaggaatcacgagcgggagaagcagaagcgaaatg
cggatgcagaaaagaacagttgttgcggtagaaggaggattgtacatgaattacaccatg
tttagagaatacatggaagaggctttggtggagattttaggagaagaagtgagccaatac
gtggtcgttaaagccatggaagatggttccagcattggctctgctcttctcgttgcctct
ttacagtcatga

KEGG   Brassica napus (rape): 106373402Help
Entry
106373402         CDS       T04128                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106373402
   00051 Fructose and mannose metabolism
    106373402
   00052 Galactose metabolism
    106373402
   00500 Starch and sucrose metabolism
    106373402
   00520 Amino sugar and nucleotide sugar metabolism
    106373402
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106373402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106373402
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106373402
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106373402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1421 Miga
Motif
Other DBs
NCBI-GeneID: 106373402
NCBI-ProteinID: XP_013669033
AA seq 490 aa AA seqDB search
MSRKVVVVAVTAATVAAAVIIGRWMRRKERRRKQTQRILRKFARECATPVSKLWTVAEAM
VADMAASLAATPAAESRGSLNMLVSFAGSLPSGDEKGLHYGANLRGKELLLLRGTLGGNE
EPISDIHKQEISIPKDVLNGSFKELCDFISLEQVKFRGMNPGEETEDVKNLGFTLTRYVE
EIRSGSISAIHRKSLADGDDDKVLKEFVNDMNESLDRHGLKIRMNMALVDDTIGILAGGR
YYHKDTVAAVTLGMGTNAAYIEQAQEVLRWKSTIPNEQQEIVISTEWGDFRSCHLPLTEF
DAALDAESLNPGSHVFEKMVSGGYLGDIVRRVLLRMSEESALFGDILPPKLKTPYILGSP
DMAAMHQDISEDRDIVNKKLKEVFGIMDSTLAAREVVVEVCDVVAERAARVAGAGIVGMI
KKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGAGAL
FFAACGNVKI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaaagtggtggttgtggccgtcactgctgcaacggttgcagcggctgtaata
ataggtcggtggatgcgtaggaaggagcggcggcggaaacagacgcagcgcattttgagg
aaatttgctagagaatgtgctacgccggtttcgaagctgtggacggtggcggaagccatg
gtcgccgatatggccgcctccctcgcagccacccccgccgccgagagtcgcggttccctc
aacatgctcgtttcgttcgccggttctctcccttcaggtgatgagaaggggttacattat
ggagcaaacttgcgaggcaaggaacttctattgttacgtggaactttaggaggtaacgaa
gagcctatttccgatatacataagcaggagatttcgatccctaaggatgttttaaatggt
tctttcaaggagttgtgcgatttcatatccttggagcaagttaaattccgtgggatgaat
cctggcgaagaaactgaagacgttaagaatctagggtttacgttaacacgctatgtcgag
gagattagatcaggttcaatctcggctatacatagaaagagtttagcagatggtgatgat
gacaaggttttgaaggagtttgtgaatgatatgaatgaatcattggatagacacggtctg
aaaattcggatgaacatggcgctggtggatgacacaataggaatattagctggaggaagg
tactatcacaaggatactgtggctgcggttactttaggtatgggaaccaacgctgcttac
atcgaacaagctcaagaggttttgagatggaaatcaacgataccaaacgagcaacaagag
attgttattagcaccgagtggggagatttcagatcttgtcatcttcctctaactgaattt
gatgctgctcttgatgcggaaagcttgaatccaggaagccacgtatttgagaagatggtg
tctggaggatacttaggggacatagtgagaagagttttgctaagaatgtctgaagaatct
gctctatttggagatatactgcctccaaagctcaaaactccttacattttagggtcgccg
gatatggctgccatgcatcaagatatatctgaagaccgagacatcgtaaacaaaaagctc
aaggaagttttcgggatcatggactcaactcttgcggcgagagaagtggtggttgaagtg
tgcgatgtagtagcggaaagagcggctcgtgtggcaggagcaggaatagttgggatgata
aagaagctgggaaggttggagaagaagatgagcattgtaatagttgaaggaggactttat
gatcattacagggtctttagaaactatcttcatagcagtgtttgggaaatgcttggcgac
gagttatcagatcatgtcgtcatcgaacattctcacggtggatctggtgccggagccctt
ttctttgccgcttgcggtaacgtcaaaatctag

KEGG   Brassica napus (rape): 106384641Help
Entry
106384641         CDS       T04128                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106384641
   00051 Fructose and mannose metabolism
    106384641
   00052 Galactose metabolism
    106384641
   00500 Starch and sucrose metabolism
    106384641
   00520 Amino sugar and nucleotide sugar metabolism
    106384641
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106384641
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106384641
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106384641
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106384641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106384641
NCBI-ProteinID: XP_013680032
AA seq 492 aa AA seqDB search
MARKEVVAVTAAVVTAVAAAVIIGQWVRRKERRRKQTQMIFKKFARECATPVSKLWAVAD
ALVADMTAFLSATTAAGSCGSLNMLVSFAGALPSGEEKGIRYGANLRGKELLLLRGTLGG
NEEPISDVHKQEISIPADVLNGSFKELCDYISLELVKFIGMNPGEETDEVKNLGFTLTRY
VEQFGPSSISAIQRKGLANDDDDTVLKEFLNDMNESLESHGLKIRMNVALVDDTIGVLAG
GRYYHKDTVAAVTLGMGTNAAYIEQAQEVLRWKPSIPNEPQEIVISTEWGDFRSCHLPVT
EYDAALDAESLNPRSCVFEKMVAGGYLGEIVRRVLLKMTQESALFGDILPPKLTTPYTLS
SPDMAAMHQDISEDREIVNKKLKDVFGIMYSTLAAREVVVEVCDVVAERAARVAGAGIVG
MVKKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGAG
ALFFAACGNVKT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaagaggtggtggcggtcactgctgcggtggttactgcggttgcagcggct
gtaataattggtcaatgggtgcggaggaaggagcggcggcggaaacaaacacagatgatt
tttaaaaaattcgctagagaatgcgccacgccggtttcgaagctatgggcggtggcggac
gccttggtagccgacatgaccgcctttctctctgccactacagccgccgggagttgcggc
tccctcaacatgctcgtttcattcgccggtgctctcccttcaggggaagagaaggggata
cgttatggagctaacttgcgaggcaaggaacttctactgttacgtggaactttaggaggt
aacgaagagcctatttccgatgtacataaacaggagatttcaatccctgcggatgtttta
aacggctctttcaaggagctgtgcgattacatatccttggagctagttaagttcattggg
atgaatcctggagaagaaacagatgaagttaagaatctagggtttacgttaacacgctat
gtcgaacagtttgggcctagttcaatctcggcgatacagaggaagggcttagcaaatgat
gatgatgacacggttttgaaggagtttttgaatgatatgaatgaatcattggagagtcac
ggactgaagattcggatgaacgtggcgctggtggatgacacaattggagtgttggctgga
ggaaggtactatcataaggacactgtggctgcagtcactttaggtatgggaactaacgct
gcttacatcgaacaagctcaggaggttctgagatggaaaccctcgataccaaacgagcca
caagagattgttattagcacggagtggggagatttcagatcatgtcatcttcctgtaact
gaatatgatgctgctcttgacgcagaaagcctgaatcctagaagctgtgtatttgagaag
atggtggctggaggatacttaggggagatagtgagaagagtgttgctaaaaatgacacaa
gaatctgctttatttggagatatactacctccaaaactgacaaccccttacactttaagt
tcgccagatatggccgcgatgcatcaagatatatcagaagatcgagagattgtaaacaaa
aagctcaaggatgttttcgggatcatgtattcaactcttgcggctagagaagtggtggtt
gaagtgtgcgatgtagtggcggaaagagcggcgcgtgtggcaggagcaggaatagttggg
atggtaaagaagctgggaaggttagagaaaaagatgagcattgtgatagttgaaggaggg
ttgtatgatcattacagggtctttagaaactatcttcatagcagtgtttgggaaatgctc
ggcgatgagttatcggaccatgtcgtcattgagcattctcacggtggatctggtgccgga
gcccttttctttgctgcttgcggcaacgttaaaacctaa

KEGG   Brassica napus (rape): 106402685Help
Entry
106402685         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106402685
   00051 Fructose and mannose metabolism
    106402685
   00052 Galactose metabolism
    106402685
   00500 Starch and sucrose metabolism
    106402685
   00520 Amino sugar and nucleotide sugar metabolism
    106402685
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106402685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106402685
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106402685
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106402685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 106402685
NCBI-ProteinID: XP_013698923
AA seq 498 aa AA seqDB search
MGKVAVAFAAAAVLVSCSVAAVMVGRRIKSRAKWRAVVEILKELEEACDTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVHHLPNGTEKGTYYALHLGGTYFRILRVHLGGERSY
LDVQDVERHPIPSHLMDSTSEVLFNFLAFSMERFIEKEGKESNSQGVKRELAFTFSFPVK
HSSISSGVLIKWTKGFEISEMVGKDVAECLQGAMNRRGLDIHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNPNDMGFEKMIAGLYLGDIVRRVIRHMSQVSDIFGPTSSMLSEPYVLRTNSVSA
MHEDDTPELQQVARILKDLGVSDVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKVGR
DGSGGITSGRSRSEMRMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKA
MEDGSSIGSALLVASLQS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggttgcggttgcgtttgcggcggctgcggttttagtgtcttgctccgtggcg
gcggtgatggtggggaggaggattaagagtcgggcgaaatggagggccgtggtggagatt
ttgaaggagttggaggaagcttgtgatactccggtggggaggctgaggcaagtggtggat
gccatggcggtggagatgcacgctgggttggcttctgaaggtggctccaagcttaaaatg
cttctcactttcgtccatcatttgcccaatgggacggagaaaggaacttattatgcactt
catcttggaggcacttactttaggattttgagggttcatctgggtggtgaaaggtcttat
ctagatgttcaagacgttgaacgacaccccataccttcacatttgatggatagcaccagc
gaggttcttttcaactttctcgccttttccatggaaaggtttatcgaaaaagaaggaaag
gaatctaattcacaaggtgtgaaaagggaactggcatttacgttttcgttccctgtcaag
cattcttctatatcttccggagttctaatcaaatggaccaaaggttttgagattagtgaa
atggttgggaaagatgtagctgaatgtctacaaggagcgatgaacagaagaggcctagat
atccatgttgcagctcttgtgaatgatactgtgggagccctgtcacttggatattatcat
gatccagatacagttgttgccgttgtatttggaacaggtagtaatgcatgttacttggaa
cgcactgatgccataatcaagtctcagggtctgcttaccacttctggaagcatggtagtc
aatatggagtggggtaatttttggtcctcacacctgccaagaacttcatatgacattgac
ttggatgcagagagttcaaatccaaatgatatgggatttgaaaagatgatagcaggattg
tatctgggtgacattgttagaagagtaatccgtcacatgtcacaagtctccgacatcttt
ggacccacctcgtccatgttatctgagccttatgttctaagaacaaattcagtttcagcc
atgcatgaagatgacacacccgagttgcaacaagtagcaagaatcttgaaagacttgggg
gtatcagatgtaccattgaaggtgagaaaactcgtagtgaagatatgcgacgtggtgaca
cgaagagcagggaggctagcagcagcgggtattgcaggaatcttgaagaaggtaggtcga
gatggtagcggaggaatcacgagcgggagaagcagaagcgaaatgcggatgcagaaaaga
acagttgtcgcagtagaaggaggattgtacatgaactacaccatgtttagagaatacatg
gaagaagctttggtggagatattaggagaagaagtgagccaatacgtggtcgttaaagcc
atggaagatggttctagcattggctctgcccttctcgttgcctctttacagtcataa

KEGG   Brassica napus (rape): 106406721Help
Entry
106406721         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106406721
   00051 Fructose and mannose metabolism
    106406721
   00052 Galactose metabolism
    106406721
   00500 Starch and sucrose metabolism
    106406721
   00520 Amino sugar and nucleotide sugar metabolism
    106406721
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106406721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106406721
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106406721
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106406721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 106406721
NCBI-ProteinID: XP_013702899
AA seq 497 aa AA seqDB search
MGKVAVAFAAAAVVAACSVAAVMVRRRVKSRRKWRSVVEILKELEEGCDTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVHELPKGTEKGTYYALHLGGTYFRILRVHLGGERSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIEKEGDGSSSQGVKRELAFTFSFPVK
HSSISSGVLIKWTKGFEISEMVGRDIAECLQVALNTRGLDMHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNSNDMGFEKMIAGMYLGDIVRRVILRMSQESDIFGPSSSLLSEPYVLRTNLVSA
MHEDDTPELQEVARILKDLGVSEVPLKVRKLVVKVCDVVTRRAGRLAAAGIAGILKKIGR
DGSGGITSGRSRSETQMQRRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKA
MEDGSSIGSALLVASSQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtcgcggttgcgtttgcggcggctgcggttgttgccgcttgttccgtggcg
gcggtgatggtgaggaggagagtaaagagtcggaggaagtggaggagtgtggtggagatt
ttgaaggagttggaggagggttgtgatactccggtggggaggttgaggcaagtggtggat
gccatggccgtggagatgcacgctggattggcttctgaaggtggctccaagcttaaaatg
ctcctcaccttcgtccatgagttgcccaaagggacggagaaaggaacttattatgcactt
caccttggaggcacttattttaggattttaagggtccatctgggtggcgaaaggtcgtat
ctagatgttcaagatgttgaacgacatcccataccttcacatttgatgaatagcaccagc
gaggttctttttaactttctcgccttttccttggaaagattcatcgaaaaagaaggagac
gggtctagttcacaaggtgttaaaagggaacttgcatttacgttttcgttccctgtcaag
catagttctatatcttcaggagttctaatcaaatggaccaaaggttttgagattagtgaa
atggttgggagagacatagctgaatgtctacaagtagcgctgaacacaagaggccttgat
atgcatgttgcagctcttgtgaatgatactgtcggagccttgtcacttggatactatcat
gacccagatacagttgttgcggttgtatttggaacaggtagtaatgcatgttacttggaa
cgaactgatgccataatcaagtctcagggtctgcttacaacttctggaagcatggtagtt
aatatggaatggggaaatttttggtcctcacacctgccaaggacttcatatgacattgac
ttggatgcagagagttcaaattcaaatgatatgggatttgagaagatgatagcaggaatg
tatctgggagacattgttcgaagagttattcttcgcatgtcacaagaatctgatatcttt
ggaccttcctcttctttgttatctgagccttacgttctaagaacaaatctagtctctgcc
atgcatgaagatgacacacctgagttgcaggaagtagcaagaatcttgaaagacttgggg
gtgtcagaagtaccattgaaggtgagaaaactagtggtgaaagtatgcgacgtggtgaca
cgaagagcggggaggctagcggcagcggggatagcagggatcttgaagaagataggcaga
gatggaagcggaggaatcacaagcgggagaagcagaagcgagacccaaatgcagagaaga
acagtggttgcagtagaaggaggtttgtacatgaactacaccatgtttagagaatacatg
gaagaagctctggtcgagattttaggagaagaagtgagtcagtacgtggtcgttaaagcc
atggaagatggttctagcattggctctgctcttctcgttgcttcttcacagtga

KEGG   Brassica napus (rape): 106416669Help
Entry
106416669         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106416669
   00051 Fructose and mannose metabolism
    106416669
   00052 Galactose metabolism
    106416669
   00500 Starch and sucrose metabolism
    106416669
   00520 Amino sugar and nucleotide sugar metabolism
    106416669
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106416669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106416669
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106416669
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106416669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 106416669
NCBI-ProteinID: XP_013713040
AA seq 501 aa AA seqDB search
MGKVAVAFAAAAVVAACSVAAVMVRRRVKSRRKWRTVVEILKEFEEGCDAPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGTYYALHLGGTYFRILRVHLGGESER
SYLDVQDVERHPIPSHLMYSSSEVLFNFLAFSLERFIQKEGNESNSQGVIRELAFTFSFP
VKHTCISSGVLIKWTKGFEISEMVGKDIAECLQGALSRRGLDIHVEALVNDTVGALSLGY
YHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTAYD
IDLDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMSQESDIFGPSSSVFSQPYVLRTNSV
SAMHEDDTPELQEVARILKDLGVSDVPLKVRKLMVKICDVVTRRAGRLAAVGIAGILKKI
GRDGGGGITGGRSRGEMQMQRRTVVGVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVV
KAMEDGSSIGSALLVASSLQS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggttgcgtttgcggcggctgcggttgtggcggcttgttcagtggcg
gcggtgatggtgaggaggagagtgaagagcaggaggaaatggaggactgtggttgagatt
ttgaaggagtttgaggaaggctgtgatgctcccgtggggaggttgaggcaggtggtggac
gctatggcggtggagatgcacgctggtttggcttccgaaggtggctccaagcttaaaatg
cttctcacttatgttcatgatttgcctaatgggacggagaaaggaacttattacgcacta
caccttggaggcacttactttaggatcttaagggttcatctgggtggtgagagtgagagg
tcatacctagatgttcaagatgttgaacgacaccctataccttcccatttgatgtatagc
agcagcgaggttcttttcaactttctcgccttttcattggaaaggtttatccaaaaagaa
gggaacgaatctaattcgcaaggtgttataagggaactcgcatttacgttttcgttccct
gtcaagcacacttgtatatcttccggagttctaatcaaatggaccaaaggttttgagatt
agtgaaatggttgggaaagacatagctgaatgtctacaaggagctctaagcagaagaggc
cttgatatccacgttgaagctcttgtaaatgatactgttggagcactgtcacttggatac
tatcatgatccagacacggttgttgcggttgtattcggaacaggtagtaacgcgtgttac
ttggagcgaaccgacgccataatcaagtgtcagggtctgcttacaacttctggaagcatg
gtggtcaatatggagtggggaaatttttggtcctcacatctgcctagaactgcatatgac
attgacttggatgcagagagttctaatccaaacgatatgggatttgagaagatgatagca
ggactgtatctaggtgacattgttcgtagagtgattcttcgcatgtcacaagaatctgat
atctttggaccttcctcgtctgtgttttctcagccttatgttctgagaacaaactcagtc
tcagctatgcatgaagacgacacacctgagttacaagaagtagcaagaatcttgaaagac
ttaggggtatcagatgtaccattgaaggtgagaaagctgatggtgaaaatatgcgacgtg
gtgacacgaagagcagggaggctagcagcagtgggaatagcagggatcttgaagaagata
ggtcgagatggtggaggaggaatcacgggcgggaggagcagaggcgaaatgcagatgcag
agaagaacagttgttggagtagaaggaggtttgtacatgaactacaccatgtttagagaa
tacatggaggaagctttggttgagattctaggagaagaagtgagtcaatacgtcgtcgtt
aaagccatggaagatggttctagcattggctctgctcttctcgttgcctcctctttacag
tcatga

KEGG   Brassica napus (rape): 106425081Help
Entry
106425081         CDS       T04128                                 

Definition
(RefSeq) hexokinase-4
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106425081
   00051 Fructose and mannose metabolism
    106425081
   00052 Galactose metabolism
    106425081
   00500 Starch and sucrose metabolism
    106425081
   00520 Amino sugar and nucleotide sugar metabolism
    106425081
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106425081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106425081
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106425081
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106425081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106425081
NCBI-ProteinID: XP_013721260
UniProt: A0A078GDI5
AA seq 505 aa AA seqDB search
MGRVVVILTTAAAVVACSVATVMVRRRVKRRRKWRKVVGLLKELEESFETPLGRLRQMVD
AIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSERGTYYALHLGGSYFRIIRVHLGGQRSS
LEVQDIERHSIPTSLLNSTSEVLFDFLASSLQRFIEKEGHESISSQDVKRELAFTFSFPV
KQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGAVDRRGLDIHVAALVNDTVGALSYGHY
HDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFWSSRLPRTSYDI
ELDAESLNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISSILSTPFVLRTNSVS
AMHEDDTPELHEVATILKHLGVSKVPLKVRKLVVKICDVVTRRAARLAAAGISGILKKLG
RDGSVGEGRRRSSDKQMMRRTVVAVEGGLYSNYRMFREYMDEALRDILGEDVARQVVIKA
MEDGSSIGSALLLASSHSVRTISNI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggagggttgtggtgattttgacgacagccgcggcggttgtggcttgttcggtggcg
acggtgatggtgaggaggagggtgaaacgtcggaggaagtggaggaaggtggtggggcta
ttgaaggaattggaggaatcgtttgagacgccgttggggaggttgaggcagatggtggat
gctatagctgttgagatgcaagctggtttggtctctgaaggagggtctaagcttaaaatg
ctcctcactttcgtcgatgatcttcctaatgggagtgagagaggaacttattacgcactt
catcttggaggctcttactttaggattataagagttcatttgggtggccaaaggtcgtct
cttgaagttcaagatatcgaaagacacagcataccgacctctttgttgaatagcaccagc
gaggttctcttcgactttctcgcatcatctttgcagaggtttattgagaaagaaggacac
gagtccatttcttcacaagatgtgaaaagggaacttgcgtttactttttctttcccagtt
aagcaaacctccctctcttcaggagttctcatcaaatggaccaaaggttttgcaattagt
gaaatggctggggaagatattgctgaatgtctacaaggagcggtggacaggagagggctg
gatatacacgtcgcagctcttgtgaatgatacagttggggccctgtcctatggacattat
catgacccagacacgattgccgctgttgtatttggaacaggtagtaatgcttgttacctc
gaacgcactgatgcaataatcaagtgtcagaatccgcgcacaacttctggaagcatggtg
gtgaacatggagtggggaaacttttggtcatctcgtcttccaagaacttcatatgacatt
gagttggatgcagagagtttgaattcaaatgacatgggatttgagaagatgataggaggg
atgtatctgggcgacattgtccgcagagtaattcttcgtatgtcacaagagtctgacatc
tttggacccatctcatccattttatcgacgccttttgttctaagaacaaattcagtctca
gcaatgcacgaagatgacacacccgagttacatgaagtagcaacaatcttgaaacattta
ggggtatcgaaggtaccactgaaggtgaggaaacttgtagtgaagatatgcgatgtagtg
acacgcagagcagctaggctagcagcagcaggaatctcaggaatcttgaagaaactgggg
agagatgggagcgtaggagaaggaagaagaagaagtagcgataagcagatgatgagaagg
acagtggtggcagtagaaggtggtctctattcgaattataggatgttcagagaatacatg
gacgaagctttgagagatatattgggagaagacgtggctcgacaagtagtgattaaggcc
atggaagatggctcgagcatcggctctgcattgttgctggcttcatctcatagcgttcga
accatatcgaacatatga

KEGG   Brassica napus (rape): 106426837Help
Entry
106426837         CDS       T04128                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106426837
   00051 Fructose and mannose metabolism
    106426837
   00052 Galactose metabolism
    106426837
   00500 Starch and sucrose metabolism
    106426837
   00520 Amino sugar and nucleotide sugar metabolism
    106426837
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106426837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106426837
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106426837
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106426837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Miga DUF1421
Motif
Other DBs
NCBI-GeneID: 106426837
NCBI-ProteinID: XP_013723020
AA seq 490 aa AA seqDB search
MTRKVVVVAVTAATVAAAVIIGRWMRRKERRRKQTQRILRKFARECATPVSKLWMVADAM
VAEMTASLAATTASESRGSLNMLVSFAGSLPSGDEKGLRYGANLRGKELLLLRGTLGGNE
EPISDVHKQEISIPEDVLNGSFKELCDYISLELVKFIGMNPGEETEDVKNLGFTLTRYVE
EIRSGSVSAIHRKSLADGDDDKVLKEFVNDMNESLDRHGLKIRMNLALVDDTIGILAGGR
YYHKDTVAAVNLGMGTKAAYIEQAQEVLRWKSTIPNEPQEIVISTEWGDFRSCHLPLTEF
DAALDAESLNPGSHVFEKMASGGYLGEIVRRVLLRMSVESALFGDIVPPKLKTPYILGSP
DMAAMHQDISEDRDIVNKKVKEVFGIMDSTLAAREVVVEVCDVVAERAARVAGAGIVGMI
KKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGAGAL
FFAACDNVKI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaaagtggtggtggtggccgtcactgctgcaacggttgcagctgctgtaata
ataggtcggtggatgcggaggaaggagcggcggcggaaacagacgcaacgcattttgagg
aaatttgctagagaatgcgctacgccggtttcgaagctgtggatggtggcggacgcaatg
gtcgccgagatgaccgcctctctcgcagccaccaccgcctcggagagtcgcggttccctc
aacatgctcgtttcattcgccggttctctcccttcaggtgatgagaaggggttacgttat
ggagctaacttgcgaggcaaggaacttctattgttacgtggaactttaggaggtaacgaa
gagcctatttccgatgtacataagcaggagatttcaatccctgaggatgttttgaatggt
tctttcaaggagttgtgcgattacatatccttggagctagttaaattcattgggatgaat
cctggcgaagaaactgaagacgttaagaatctagggtttacgttaacacgctatgtcgag
gagattaggtcaggttcagtctcggcgatacatagaaagagtttagcagatggtgatgat
gacaaggttttgaaggagtttgtgaatgatatgaatgaatcattggatagacacggtctg
aaaattcggatgaacttggcgctggtggatgacacaataggaatattagctggaggaagg
tactatcacaaggatactgtggctgcggttaatttaggtatgggaaccaaagctgcttac
atcgaacaagctcaagaggttttgagatggaaatcaacgataccaaacgagccacaagag
attgttattagcaccgagtggggagatttcagatcttgtcatcttcctctaactgaattt
gatgctgctcttgatgcggaaagcttgaatccaggaagccacgtatttgagaagatggcg
tctggaggatacttaggggagatagtgagaagagtgttgctaagaatgtccgtagaatct
gctctatttggagatatagtgcctccaaaactcaaaactccttacatcttagggtcgccg
gatatggctgccatgcatcaagatatatctgaagaccgagacatcgtaaacaaaaaggtc
aaggaagttttcgggatcatggactcaactcttgcggcgagggaagtagtggttgaagtg
tgcgatgtagtagcggaaagagcggctcgtgtggcaggagcaggaatagttgggatgata
aagaagctgggaaggttagagaagaagatgagcattgtaatagttgaaggaggactttat
gatcattacagggtctttagaaactatcttcatagcagtgtttgggaaatgcttggcgac
gagttatcagatcatgtcgtcatcgaacattctcacggtggatctggcgccggagctctt
ttctttgccgcttgcgataacgttaaaatctag

KEGG   Brassica napus (rape): 106439029Help
Entry
106439029         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106439029
   00051 Fructose and mannose metabolism
    106439029
   00052 Galactose metabolism
    106439029
   00500 Starch and sucrose metabolism
    106439029
   00520 Amino sugar and nucleotide sugar metabolism
    106439029
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106439029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106439029
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106439029
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106439029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106439029
NCBI-ProteinID: XP_013735822
AA seq 499 aa AA seqDB search
MGKVAVAFASAAVVAACSVAAVMVRRRVKSRRKWRTVVEIVKEFEEGCDAPVGRLRHVVD
AMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGTYYALHLGGTYFRILRVHLGGERSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIQKEGNESNSQGVKRELAFTFSFPVK
HTCISSGVLIKWTKGFEISEMVGKDIAECLQGALNRRGLDIHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTAYDID
LDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMSQESDIFGPSSSVFSQPYVLRTNSVSA
MHEDDTPELQEVARILKDLGVSDVPLKVRKLMVKICDVVTRRAGRLAAAGIAGILKKIGR
DGGGGITSGRSRGEMQMQRRTVVGVEGGLYMKYTMFREYMEEALVEILGEEVSQYVVVKA
MEDGSSIGSALLVASSLQS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggttgcgttcgcctcggctgcggttgtggcggcttgttcagtggcg
gcggtgatggtgaggaggagagtgaagagcagaaggaaatggaggactgtggttgagatt
gtgaaggagtttgaggaaggctgtgatgctcctgtggggaggttgaggcatgtggtggac
gctatggcggtggagatgcacgctggtttggcttctgaaggtggctccaagcttaaaatg
cttctcacttatgttcatgatttgcctaatgggacggagaaaggaacttattatgcacta
caccttggaggcacttactttaggatcttaagggttcatctgggtggtgagaggtcatac
ctagatgttcaagatgttgaacgacaccctataccttcccatttgatgaatagcaccagc
gaggttcttttcaactttctagccttttcattggaaaggtttatccaaaaagaaggaaac
gaatctaattcgcaaggtgttaaaagggaactcgcatttacgttttcgttccctgtcaag
cacacttgtatatcttccggagttctaatcaaatggaccaaaggttttgagattagtgaa
atggttgggaaagacatagctgaatgtctacaaggagctctaaacagaagaggccttgat
atccacgttgcagctcttgtaaatgatactgttggagcactgtcacttggatactatcat
gatccagacacggttgttgcggttgtattcggaacaggtagtaacgcgtgttacttggag
cgaaccgacgccataatcaagtgtcagggtctgcttacaacttctggaagcatggtggtc
aatatggagtggggaaatttttggtcctcacatctgcctagaactgcatatgacattgac
ttggatgcagagagttctaatccaaacgatatgggatttgagaagatgatagcaggactg
tatctaggtgacattgttcgtagagtgattcttcgcatgtcacaagaatctgatatcttt
ggaccttcctcgtctgtgttttctcagccttacgttctgagaacaaactcagtctcagct
atgcatgaagacgacacacctgagttacaagaagtagcaagaatcttgaaagacttaggg
gtatcagatgtaccattgaaggtgagaaagctgatggtgaaaatatgcgacgtggtgaca
cgaagagcagggaggctagcagcagcgggaatagcggggatcttgaagaagataggtcga
gatggtggaggaggaatcacgagcgggaggagcagaggcgaaatgcagatgcagagaaga
acagttgttggagtggaaggaggtttgtacatgaagtacaccatgtttagagaatacatg
gaggaagctttggttgagattctaggagaagaagtgagtcaatacgtcgtcgttaaagcc
atggaagatggttctagcattggctctgctcttctcgttgcctcctctttacagtcatga

KEGG   Brassica napus (rape): 106445383Help
Entry
106445383         CDS       T04128                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445383
   00051 Fructose and mannose metabolism
    106445383
   00052 Galactose metabolism
    106445383
   00500 Starch and sucrose metabolism
    106445383
   00520 Amino sugar and nucleotide sugar metabolism
    106445383
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106445383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106445383
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106445383
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106445383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 106445383
NCBI-ProteinID: XP_013742381
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVFAATVYVVRRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDR
VVKQEFEEVSIPPPLMTGASDELFNFIAEALARFVATEGEDFHLPAGRQRELGFTFSFPV
KQTSLCSGTLISWTKGFSIEDALGQDVVGELIKAMERVGLDMNVTALVNDTVGTLAGGRY
YNSDVVAAVILGTGTNAAYVERANAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
LLDFDSLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTM
SAMHSDTSPDLKVVGSKLKDILEVPTTLKMRKVVISLCNIIATRGARLSAAGIYGILKKL
GRDAPKDGETTQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGV
GAALLAASHSQYLEDSETS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttggtgcgacggtcgtgtgcgctgcggcggttttcgcggcgacg
gtgtatgtggtgaggcggcggatgaaaagctgcgggaaatgggggcgcgtgatagagatc
ctgaaggtgttcgaggaggattgcgcgacgccgatagggaagctgagacaagtggcggat
gcgatgacggttgagatgcacgcgggtctcgcatcggaaggtggaagcaagcttaagatg
ctcatcagctacgtcgacaatctcccttctggggatgaacaaggtttcttttacgcgctg
gacctaggaggaacaaacttccgtgtcatgcgtgtgcttctcggtggcaaacaagaccgt
gttgtcaaacaagaattcgaagaagtctctatccctcctcctttgatgaccggtgcttca
gatgaattgttcaattttatcgctgaagcgcttgcaaggtttgtagctacggaaggagag
gactttcatctcccagcgggtagacaaagggagttaggtttcactttctcgtttcctgtt
aagcagacgtctttgtgctctggcactctcatcagctggactaaaggcttctccatcgaa
gatgcacttggacaagatgttgtgggagagcttattaaagctatggaaagagttgggctc
gacatgaatgtcacagcgcttgttaatgatacggttggaacacttgctggtggtagatac
tataactctgatgttgtagccgctgttattctaggcactggcactaatgcagcttatgtc
gaacgcgcaaatgccattccaaaatggcagggcttacttcccaaatctggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcacatcttcccttgaccgagtacgaccac
ttgctggatttcgatagtttgaatcctggtgaacagattcttgagaaaatcatttccggt
atgtatttgggagagatcttgcgtagagttcttctgaagatggctgaagaggctgctttc
tttggcgactccatcccacctaagctgaaagtaccattcatcataaggactccgaccatg
tctgctatgcacagcgacacttctccggacttgaaggttgttggaagcaagttaaaggac
atactggaggtccctactactctgaagatgagaaaagttgtgatcagtctctgtaacata
atcgccacccgaggagctcgtctctctgcagctgggatctacggaatcctcaagaaacta
ggaagagacgcaccgaaagatggagaaacaacgcagaaatctgtgattgccatggacggt
ggactgttcgagcactacactcagttcagcgagtgtatggagagctcattgaaagagttg
cttggagatgaagcatcagagagcgtcgaggtgattcattcgaatgacgggtccggcgtt
ggcgctgcattgctcgctgcctcgcactctcagtacctcgaggactctgaaacaagttaa

KEGG   Brassica napus (rape): 106447109Help
Entry
106447109         CDS       T04128                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106447109
   00051 Fructose and mannose metabolism
    106447109
   00052 Galactose metabolism
    106447109
   00500 Starch and sucrose metabolism
    106447109
   00520 Amino sugar and nucleotide sugar metabolism
    106447109
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106447109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106447109
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106447109
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106447109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 106447109
NCBI-ProteinID: XP_013744424
UniProt: A0A078IHX3
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVCAATVYVVRRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDR
VVKQEFEEVSIPPPLMTGASDELFNFIAEALAKFVATEGEDFHLQAGRQRELGFTFSFPV
KQTSLCSGTLINWTKGFSIEDALGKDVVGELIKAMERVGLDMNVTALVNDTVGTLAGGRY
YNSDVVAAVILGTGTNAAYVERASAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
LLDFDSLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTM
SAMHSDTSPDLKVVGSKLKDILEVPTTLKMRKVVISLCNIIATRGARLSAAGIYGILKKL
GRDAPKDGEATQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGV
GAALLAASHSQYLEDSETS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttggtgcgacggtggtttgcgctgcggcggtgtgcgcggcgacg
gtgtacgtggtgaggcggcggatgaaaagctgcgggaaatgggggcgcgtgatagagatc
ctgaaggtgttcgaggaggattgcgcgacgccgatagggaagctgagacaagtggcggat
gcgatgacggttgagatgcacgccggtctcgcttcggaaggtgggagcaagcttaagatg
cttatcagctacgtcgacaacctcccttctggggatgaacaaggtttcttttacgcgctg
gacctaggaggaacaaacttccgtgtcatgcgtgtgcttctcggtggcaagcaagaccgt
gttgtcaaacaagaattcgaagaagtctctatccctcctcctttgatgaccggtgcttca
gatgaattgttcaattttatcgccgaagcgcttgcaaagtttgtagctacggaaggagag
gactttcatctccaagcgggtagacaaagggagttaggtttcactttctcgtttcctgtt
aagcagacgtctttgtgctctggcactctcatcaactggactaaaggcttctccatcgaa
gatgcacttggaaaagatgttgtgggagagcttattaaagctatggaaagagttgggctc
gacatgaatgtcactgcgcttgttaatgatacggttggaacacttgctggtggtagatac
tataactctgatgttgtagccgctgttattctaggcactggcactaatgcagcttatgtc
gaacgcgcaagtgccatcccaaaatggcagggcttacttcccaaatctggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcacatcttcccttgaccgagtacgaccac
ttgctggatttcgatagtctgaatcctggtgaacagattcttgagaaaatcatttccggt
atgtatttgggagagatcttgcgtagagttcttctgaagatggctgaagaggctgctttc
tttggcgactccatcccacctaagctgaaagtaccattcatcataaggactcctaccatg
tctgctatgcacagcgacacttctccggatttgaaggttgttggaagcaagttaaaggac
atactcgaggtccctactactctgaagatgagaaaagttgtgatcagtctctgtaacatc
atagccacccgaggagctcgtctctccgcagctgggatctacggaatcctcaagaaacta
ggaagagacgcaccgaaagatggggaagcaacgcagaaatctgtgattgccatggacggt
ggactgttcgagcactacactcagttcagtgagtgtatggagagctcactgaaagagttg
cttggagatgaagcatcagggagcgtcgaggtgattcattcgaatgacgggtccggcgtt
ggcgctgcattgctcgctgcctcgcactctcagtacctcgaggactctgaaacaagttaa

KEGG   Brassica napus (rape): 106449712Help
Entry
106449712         CDS       T04128                                 

Definition
(RefSeq) hexokinase-like 1 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106449712
   00051 Fructose and mannose metabolism
    106449712
   00052 Galactose metabolism
    106449712
   00500 Starch and sucrose metabolism
    106449712
   00520 Amino sugar and nucleotide sugar metabolism
    106449712
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106449712
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106449712
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106449712
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106449712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106449712
NCBI-ProteinID: XP_013746883
AA seq 497 aa AA seqDB search
MSLVTFAASPLVITPTVRSFTFSPPIRRSNNTVMSAVRSEATSTCPVLTKFKKDCATPTP
FLRDVANAIADDMQAGLAVHGGGDLEMILTYVDALPSGKEEGLFYALDLGGTNFRVRSVQ
LGGEEERVVATKSEQLSIPQKLMIGTSEELFGFIASKLADFVAKEEPGRFRLDQGRKREI
GFTFSFPVNQTSIDSGTLIKWTKGFNVSGMEGKNVVACLNEAMEAHGLDMRVSALVNDGV
GTLAGARYWDKDVMAGVILGTGTNACYVEQKHAIPKLQNQSSSGTTIINTEWGGFSKCLP
RTIFDQEMDKDSLNPGEHLYEKMISGMYLGEIVRRVLLHMCQTSDLFGQDVPAKLETPLA
LKSQDLCKMQEDDTDDLSSVGSILYNIFEVKADLKDRRRVVEVCDTVVKRGGRLAGAGIV
AILERIERETKRLASGQRTVVAMDGALYEKYPQYRQYMQDALVELLGDELASHVQIKHTK
DVSGLGAALLAATNSIY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgttacctttgctgcttcccctcttgttattaccccaaccgttagatctttc
accttctcaccacctattcgtcgctccaataacaccgtaatgtccgccgtccgatctgag
gccacttcaacatgtcctgtactgaccaagtttaagaaggactgtgccacccctacgccg
ttcttacgcgacgtagccaacgccattgccgatgacatgcaagccggtctagctgtccat
ggaggaggagatctcgagatgatcttgacttatgttgatgctttgccttctgggaaggag
gaaggtttgttctatgcattggatttaggtggaacaaactttcgggtgcgtagcgtacag
ttaggaggagaggaagaacgtgtcgtagctaccaagtctgagcagctatctattcctcag
aagcttatgattggtacaagtgaggaactcttcgggttcattgcttcaaagcttgcagat
ttcgttgcaaaggaggagccagggcggtttaggttggatcaaggaaggaaaagggagatt
gggtttactttctccttccctgtgaatcaaacctctattgattcaggaacacttatcaag
tggactaaaggctttaatgtctctggaatggaaggtaaaaatgtggttgcctgtttaaat
gaagctatggaagcacatggacttgatatgcgagtttctgctctcgtaaatgatggagtg
ggaacattagctggagcaaggtattgggacaaagatgtgatggccggtgtgattcttggc
actgggaccaatgcttgttatgttgagcagaagcatgcaattcctaaactccaaaaccaa
tcttcttctggaacaacgatcataaacacagagtggggaggtttctctaagtgtcttcca
cgaaccatttttgaccaagagatggataaggatagcttaaatcctggtgaacatttatac
gagaagatgatctcagggatgtaccttggtgaaattgtaaggagggttttgctccatatg
tgtcaaactagtgacttgttcggacaagatgttcctgccaaactagaaactcctttggca
ctcaagagccaggatctatgcaaaatgcaagaggacgatacagatgatctttcaagtgtt
ggatcaatcctatacaacattttcgaggtaaaggcggatctgaaggataggaggagagtg
gtggaagtgtgtgacacggtagtgaaacgcggaggacgtctagcaggagctggtatagtg
gcaattctggagaggattgagagagagacaaaaagactggcttcaggtcaaagaaccgtt
gtagctatggacggtgcactctacgagaagtacccgcagtatcgacagtatatgcaagat
gcactagttgagcttcttggtgatgaacttgcaagtcacgttcagattaaacataccaaa
gatgtgtctgggcttggtgctgctcttttggccgctactaactccatttattag

KEGG   Brassica napus (rape): 111207313Help
Entry
111207313         CDS       T04128                                 

Definition
(RefSeq) hexokinase-like 1 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111207313
   00051 Fructose and mannose metabolism
    111207313
   00052 Galactose metabolism
    111207313
   00500 Starch and sucrose metabolism
    111207313
   00520 Amino sugar and nucleotide sugar metabolism
    111207313
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111207313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    111207313
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111207313
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111207313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111207313
NCBI-ProteinID: XP_022561018
AA seq 496 aa AA seqDB search
MSLFTFAASPLVITLTVRSFTFSPPRCSKHTVMSAVRSESTSTCPVLTKFQKNCATPTTF
LRVVADAIADDMQAGLAVHGGGDLEMILTYVDALPSGKEEGLFYALDLGGTNFRVRSVQL
GGEEERVVATKSEQLSIAQKLMIGTSEELFGFIASKLADFVAKEEPGRFRLEHGRKREIG
FTFSFPVNQTSIDSGTLIKWTKGFNVSGMEGKNVVACLNEAMEAHGLDMRVSALVNDGVG
TLAGARYWDKDVMAGVILGTGTNACYVEQKHAIPKLQNQSSSGTTIINTEWGGFSKCLPR
TIFDQEMDKDSLNPGEHLYEKMISGMYLGEIVRRVLLHMCQTSDLFGQSVPAKLATPLTL
KSQDLCKMQEDDTDDLSSVGSILYNIFEVKADLKERRRVVEVCDTVVKRGGRLAGAGIVA
ILERIERETKRLASGQRTVVAMDGALYEKYPQYRQYMQDALVELLGDELACHVQIKHTKD
VSGLGAAVLAATNSIY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcttcacctttgctgcttcccctcttgttattaccctaaccgttagatctttc
accttctcaccaccccgttgctccaaacacactgtaatgtccgccgtccgatctgagtcc
acttcaacatgtcctgttctgaccaagtttcagaagaactgtgccacccctacaacgttc
ttacgcgtcgtagccgacgccattgctgatgacatgcaagccggtctagctgtccatgga
ggaggagatctcgagatgatcttgacttatgtggatgctttgccttctggaaaggaggaa
ggtttgttctatgcattggatttaggtggaacaaactttcgggtgcgtagcgtacagtta
ggaggagaggaagaacgtgtcgtagctaccaaatctgagcaactatctattgctcagaag
cttatgattggtacaagtgaggaactcttcgggttcatcgcttcaaagctcgcagatttc
gtggcaaaggaggagccagggcggtttcggttggaacacgggaggaaaagggagattggg
tttactttctccttccctgtgaatcaaacctccattgattcaggaacacttatcaagtgg
actaaaggctttaatgtgtctggaatggaaggtaaaaacgtggttgcatgtttaaatgaa
gctatggaagcacatggacttgatatgcgagtttctgctcttgtaaatgatggagtggga
acattagctggagcaaggtattgggacaaagatgtgatggccggtgtgattcttggcact
gggaccaatgcttgttatgttgagcagaagcatgcaattcctaaactccaaaaccaatct
tcttctggaacaacgatcataaacacagagtggggaggtttctctaagtgtcttccacga
accatttttgaccaagagatggataaggatagcttaaatcctggtgaacatttatatgag
aagatgatctcggggatgtaccttggtgaaattgtgaggagagttttgctccatatgtgt
caaactagtgacttgttcggacaatccgttcctgccaaactagcaactcctttgacactc
aagagccaggatctatgcaaaatgcaagaggacgatacagatgatctttcaagtgttgga
tcgatcctatacaacatttttgaggtaaaggcggatctgaaggagaggaggagagtggtg
gaagtgtgtgacacggtagtgaaacgcggaggacgtctagcaggagctggtatagtggca
attctggagaggattgagagagagacaaaaagactggcttcaggtcaaagaaccgttgtg
gctatggacggcgcactctacgagaagtacccgcagtatcgacagtatatgcaagatgca
ttagttgagcttcttggtgatgaacttgcatgtcacgttcagattaaacataccaaagat
gtgtctgggcttggtgctgctgttttggccgctactaactccatttattag

DBGET integrated database retrieval system