KEGG   Brassica napus (rape): 106357706Help
Entry
106357706         CDS       T04128                                 

Definition
(RefSeq) serine/threonine-protein kinase MHK-like isoform X1
  KO
K08829  male germ cell-associated kinase [EC:2.7.11.22]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106357706
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106357706
Protein kinases [BR:bna01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   106357706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FTA2 RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 106357706
NCBI-ProteinID: XP_013652848
AA seq 441 aa AA seqDB search
MERYKFLEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECMNLREVKALRKLNHP
HIIKLKEIAREHNELFFIFECMDHNLYQIMKEREQRPFSEGEIRSFMSQMLQGLSHMHKN
GYFHRDLKPENLLVTNNILKIADFGLAREVASMPPYTEYVSTRWYRAPEVLLQSSSYTPA
VDMWAVGAILAELFAFSPLFPGESEIDQLYKICSVLGKPDWTTFPEAKSISRIMSISHTE
FPQTRIADLLPNASPEAIDLITRLCSWDPLKRPTADEALNHPFFNMATQASYPLHDLELR
LNTMAAEMPNLELNLWDFNTKQDECFLGLTLAVKPSAPKLEMVCNASQDMSENFLFCPMV
NNDREPSVFWSLLSPDENRVHAPVESSCPLSLSFSPVQQHTSVGPPQQSTTGFTMGSSMQ
PNMLDRPWMAVSAPFQQTHYL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatataagtttctggaagagcttggagatggtacatgtggcagtgtatataag
gctgtcaatcttgaaacatatgaagttgttgctgttaagaagatgaagagaaagttttat
tattgggaagagtgcatgaatctgcgagaagtaaaggctcttcgcaagctaaaccatcct
catatcataaagttgaaggagattgcgagggaacataacgagcttttcttcatctttgag
tgcatggatcacaatctataccaaataatgaaagaaagggaacaaagacctttctctgag
ggagagataagaagtttcatgtctcagatgcttcaaggcctctcccacatgcataaaaat
ggttacttccatagagacctgaaaccagagaatttgctggtgacaaacaacatcctgaaa
attgctgactttggactggctagagaagttgcatctatgcctccttacactgaatatgtg
tctactcgttggtatcgagctccagaagttttgctacagtcttcctcatacactcctgca
gttgacatgtgggcagtgggggcaatattagctgagcttttcgccttttctcccttattt
cctggtgaaagtgagatagatcaattatacaagatttgctctgttcttggcaagcctgac
tggactacgtttcctgaagcaaaaagcatatctcggatcatgagcattagccacacagag
tttcctcaaacaaggattgctgatctactccccaatgcttctcctgaagctattgatttg
atcactagactttgctcatgggatccattgaaacgaccaactgctgatgaggcgctaaac
catcccttcttcaatatggctacgcaggcttcttatcctctacatgaccttgagttgagg
cttaacaccatggcagcggagatgcctaaccttgagcttaacctctgggacttcaacaca
aaacaagatgaatgttttctcggcttgaccctggctgtaaaaccaagtgctcctaaacta
gaaatggtctgcaatgcatctcaggacatgagtgagaactttctcttttgccctatggtt
aacaatgatcgtgaaccatcagttttctggtctctgctctctcctgatgaaaaccgcgtc
cacgcacctgttgaatcatcatgtcctctatctctgtccttcagtccagtgcagcaacac
acaagcgtgggacctccacaacagtcaacaacagggttcaccatgggatcatcaatgcaa
ccgaacatgttggaccgcccatggatggctgtgtctgcgccgtttcaacaaactcattac
ctctga

DBGET integrated database retrieval system