KEGG   Brassica napus (rape): 106359929Help
Entry
106359929         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106359929
   00030 Pentose phosphate pathway
    106359929
   00051 Fructose and mannose metabolism
    106359929
   00052 Galactose metabolism
    106359929
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106359929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106359929
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106359929
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106359929
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106359929
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106359929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106359929
NCBI-ProteinID: XP_013655002
AA seq 512 aa AA seqDB search
MDVLISSATMCISPKNPLLVRSARPGSLILPKPRSPANSVKFHRVAAVAAARATAIDLSD
PEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCLKMRSPTYINNKDRVLLKVINYSSP
ASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIVTCGGLCPGLNDVIRLIVITL
EIYGVKNIVGIPFGYRGFSDKNLPEIPLSRKVVQNIHLSGGSLLGVSRGGPTVTEIVDSM
EERGINMLFVLGGNGTHAGANAIHNECVKRRMKVAVVGVPKTIDNDILHMDKTFGFDTAV
EEAQRAINSAYIEAHSAYHGIGVVKLMGRSSGFIAMQASLASGQVDICLIPEVPFNLHGP
DGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTNAKDASGNKVLGDIGVHIQQETKKYFK
EIGVAADVKYIDPTYMIRAVRANASDGILCTVLGQNAVHGAFAGYSGITVGIINNHYAYL
PIPEVIAYDKSVDPNSRMWHRCLTSTGQPDFL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcttatctcttcggccacgatgtgcatatctcccaagaaccccctcctcgtc
cgttctgcccggcctggttctttgatcctccctaaaccgagatctccagcgaattcggtc
aaatttcatcgagtagcggcggtggcggctgcgagagcaacggctattgatctaagcgat
cccgagtggaaactaaagtatcagagagacttcgaggagagattcaacatccctcatatc
actgatgcgttcccagatgcagaagccatcccttccacgttttgtctcaagatgaggtct
ccgacgtacattaataacaaagatagagtactcctcaaggttataaactactcatcacca
gcttctgctggagcagtgtgtattgatcctgactgcacttggattgagcaatgggttcaa
cgtgctgggccacgggaaaatatttacttcagacctgaggatgtgaaggcagctattgtt
acttgtggtgggctttgtcctggtcttaatgatgtcattagacttattgtcatcacttta
gagatatatggtgtgaagaacattgttgggattccttttggttaccgtggcttctctgat
aagaacctacctgaaatccctttgtcaagaaaagtggtgcagaacattcatctttccggt
ggaagtttgctcggggtttcacgtggaggaccgactgttactgaaatcgtggacagcatg
gaggagagaggaatcaacatgcttttcgtgcttggtggtaatggaactcatgctggtgcc
aatgctatacacaatgagtgtgtcaaaagaaggatgaaggtagctgtggttggtgtaccg
aaaacaattgacaatgatattttgcatatggataaaacatttgggtttgacactgctgtt
gaagaagcacaacgagctattaactccgcatacatcgaggcacatagtgcttaccatggc
ataggcgttgtgaaactgatgggtcgtagcagtggattcatcgccatgcaagcatcctta
gcgagtggacaagtcgacatttgtctcattcccgaggttcctttcaacctccatggacct
gatggtgtactgaaacatctgaactaccttatcgaaacaaaaggctctgctgtagtttgc
gttgcggaaggagcagggcagagtttccttgagaatacaaatgcaaaagatgcatctgga
aacaaagtactcggtgacatcggtgtgcacattcaacaagagacgaagaagtacttcaag
gagattggtgttgcggcagatgtgaagtatatagatccaacatacatgatccgagctgta
cgtgcaaatgcatcagatggaatcctctgcacggtcttaggacaaaacgctgttcatgga
gcttttgctgggtacagtggaataactgtggggataataaacaatcattatgcttactta
cccattcctgaagtgattgcttatgacaaatcagttgatcccaatagtcgaatgtggcat
cgttgcttaacttccacaggccagcctgattttttgtaa

KEGG   Brassica napus (rape): 106361379Help
Entry
106361379         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106361379
   00030 Pentose phosphate pathway
    106361379
   00051 Fructose and mannose metabolism
    106361379
   00052 Galactose metabolism
    106361379
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106361379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106361379
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106361379
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106361379
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106361379
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106361379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106361379
NCBI-ProteinID: XP_013656568
AA seq 512 aa AA seqDB search
MDVLISSATMCISPKNPLLVRSARPGSLILPKPRSPANSVKFHRVAAVAAARATAIDLSD
PEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCVKMRSPTYINTKDRVLLKVINYSSP
ASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIVTCGGLCPGLNDVIRLIVITL
EIYGVKNIVGIPFGYRGFSDKNLPEIPLSRKVVQNIHLSGGSLLGVSRGGPTVTEIVDSM
EERGINMLFVLGGNGTHAGANAIHNECVKRRMKVAVVGVPKTIDNDILHMDKTFGFDTAV
EEAQRAINSAYIEAHSAYHGIGIVKLMGRNSGFIAMQASLASGQVDICLIPEVPFNIHGP
NGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTNAKDASGNTILGDFGVHIQQETKKYFK
EVSMPVDVKYIDPTYMIRAVRANASDGILCTVLGQNAVHGAFAGYSGITVGIINTHYAYL
PIPEVIAYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcttatctcttcggccaccatgtgcatatctcccaagaaccccctcctcgtc
cgttctgcccggcctggttctttgatcctccctaaaccgagatctcctgcgaattcggtc
aaatttcatcgagtagcggcggtggcggctgcgagagcaacggctattgatctaagcgat
cccgagtggaaactaaagtatcagagagacttcgaggagagattcaacatccctcatatc
actgatgcgttccctgatgcagaagccatcccttccacgttttgtgtcaagatgaggtct
ccgacgtacattaataccaaagatagagtactcctcaaggttataaactactcatcacca
gcttctgctggagcagtgtgtattgatcctgactgcacttggattgagcaatgggttcaa
cgtgctgggccacgggaaaatatttacttcagacctgaggatgtgaaggcagctattgtt
acttgtggtgggctttgtcctggtcttaatgatgtcattagacttattgtcatcacttta
gagatatatggtgtgaagaacattgttgggattccttttggttaccgtggcttctctgat
aagaacctacctgaaatccctttgtcaagaaaagtggtgcagaacattcatctttccggt
ggaagtttgctcggggtttcacgtggaggaccgactgttactgagatcgtggacagcatg
gaggagagaggaatcaacatgcttttcgtgcttggtggtaatggaactcatgctggtgcc
aatgctatacacaatgagtgtgtcaaaagaaggatgaaggtagctgtggttggtgtaccg
aaaacaattgacaatgatattttgcatatggataaaacatttgggtttgacactgctgtt
gaagaagcacaacgagctataaactctgcctacattgaggcacatagtgcttatcatggc
atcgggattgtaaaactgatgggtcgtaacagtggtttcattgccatgcaagcctcttta
gctagcggacaagtcgacatctgtttgattcctgaggttcctttcaatattcatggacct
aatggtgtactgaagcacttgaagtaccttatcgaaacaaaaggctccgctgtgatctgt
gtagcagaaggagctggacagaatctcctcgagaaaactaatgcaaaagatgcttctgga
aacacgatacttggtgatttcggtgtccacattcaacaagagacgaaaaagtactttaaa
gaagtaagtatgccagtagatgtgaagtacattgatccaacatacatgattcgagctgtc
cgtgcaaatgcctcagatggtatcctctgcaccgttcttggacaaaacgctgttcatggt
gcatttgctggatacagtggcatcacagtaggcataatcaacactcattacgcgtatttg
ccaatccctgaagtaattgcgtatccaaagtcagtcgatcccaatagtcgaatgtggcat
cgttgcttgacttcaacaggccaaccagatttcatctaa

KEGG   Brassica napus (rape): 106365546Help
Entry
106365546         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106365546
   00030 Pentose phosphate pathway
    106365546
   00051 Fructose and mannose metabolism
    106365546
   00052 Galactose metabolism
    106365546
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106365546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106365546
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106365546
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106365546
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106365546
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106365546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106365546
NCBI-ProteinID: XP_013660458
AA seq 463 aa AA seqDB search
MDSNGVDEQEMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDEDD
TVPQKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLH
YMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQD
REINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEE
AQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGG
LYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAK
QRKMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYI
PFNRITEKQNKVVITDRMWARMLSSTNQPSFMNPPNGVTEGAN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaacggcgtcgatgagcaggagatgaagttggtgcaaggagctgctggctac
gttctcgaagatgttcctcacttgaccgattacattctcgatctccccacttatccaaac
ccgttgcaatcaaatcccgcttattcagtagtgaggcagtattttgttgatgaggacgat
acagtcccacaaaagattgttgttcacaaggattctcctagagggacacattttagacga
gctggaccacgacaaaaggtgtatttcaagccagctgatgtacgggcatgtattgtcaca
tgtggtggtctatgccctggtcttaatacagtaatcagggagattgtctgtggtcttcac
tacatgtatggtgtcacagaagtacttggtgtgaattgtgggtttagtggtttctattcc
aaaaacactgtcactctgacaccgaaggatgttagtgacatccacaagcgcgggggaacc
atgttaggaacatctcgagggggacatgatacatcaaagatcgtcgacaacatacaggac
cgtgaaataaaccaggtttacatcattggaggtgatggaacccaaaagggagcatctgca
atatacaaggagattagacgccgtggacttaaagttgctgtcgcaggaataccaaaaacc
attgacaacgacatcccagttattgacaagtcgtttggatttgatactgcggttgaggag
gctcaacgtgccatcaatgcagcgcatgttgaagcgaccagtgtggaaaacggcattggt
cttgtcaagctaatgggtcgctacagtgggttcattgcaatgtacgcgactctggccagc
cgggacgttgactgctgtctgattccagagtcgcctttttaccttgaaggcaaaggaggg
ctttacgagttcattgcaaaacggctgagagaaaatggccacatggttatagtggttgct
gaaggtgcaggacaagatctcgtcgccgagagcattgaacagcaagatgcttcggggaac
aagctccttaaagatgttggactatggatgagtcttaaaatcaaggaacactttgcgaag
cagagaaaaatggacattactctgaaatacattgatccgacatacatgatcagagctatc
ccagccaatgcatctgacaacgtttactctactctcctcgcccaaagcgcagtccatggg
gcaatggcgggctataccggcttcatctctggccttgttaatggaaggcacacttacatt
cccttcaaccgaataacggaaaaacagaacaaagttgtgattacagacagaatgtgggct
cggatgctgtcatccacgaaccagccaagctttatgaaccctcctaatggagtcacagag
ggggcaaactga

KEGG   Brassica napus (rape): 106368673Help
Entry
106368673         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106368673
   00030 Pentose phosphate pathway
    106368673
   00051 Fructose and mannose metabolism
    106368673
   00052 Galactose metabolism
    106368673
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106368673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106368673
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106368673
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106368673
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106368673
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106368673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106368673
NCBI-ProteinID: XP_013664139
AA seq 539 aa AA seqDB search
MDTLSPPIITSTLSIPYSNSSVLLRSHGLSSLILRKPRSPAANLSLISSRSSFTRASAVE
HGKSSVSIDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRSTFCLKMRSPTEEFVGG
YPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDSDCSWVEQWIHRAGPREKIYFRPE
QVKAAIITCGGLCPGLNDVIRHIVITLEIYGVKNIVGIPFGYKGFSDKDLTEMPLSRKVV
QNIHLSGGSLLGVSRGGPSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHNECRKRKMK
VAVVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGIVKLMGRNSGF
IAMQASLASGQVDICLIPEVPFNIHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKT
NAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILCTVL
GQNAVHGAFAGYSGITGGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatactctctctccgcctatcatcacctccaccctctcgattccttacagcaacagc
tctgttctcctgaggtctcacggtctcagctcgttaatcctccggaaaccgagatctccg
gcggcgaatctctcgctgatctcttctcgcagctctttcactcgagcttcagcggttgaa
cacggcaaaagctcggtttcgatagatctcagcgatccgaattggaaaagaaagtacgag
agagagttcgaggaaagattcagcatccctcacatcactgacgtcttcccagatgctgaa
gctatccgttctacgttttgtctcaagatgaggtctcctacggaggaatttgttggtggt
tatccttctgatgaagaatggcatggatacattaataacaatgatagggttcttctcaag
gttattagttactcttcaccaacttctgctggagctgagtgcattgattccgactgttct
tgggttgagcaatggattcaccgtgctgggccgagggagaagatatacttcagaccggaa
caagtgaaggctgccatcatcacttgtggtgggctttgtcctggtctcaatgatgtcatc
agacatattgtcatcactcttgagatttatggtgttaagaacattgttgggattcctttt
ggttataaaggcttctctgataaagatctaaccgaaatgccgttatcaaggaaagtggta
cagaacattcatctatctggaggaagcttgcttggagtttcacgtggaggtcccagtgtc
agcgagattgttgacagcatggaggagagaggaatcaacatgctttttgtgcttggtgga
aacgggactcatgctggtgccaacgctatacacaatgagtgccgcaaaagaaagatgaag
gtagctgttgttggtgtgccaaagaccattgacaatgatatattgcacatggataagaca
tttgggtttgacactgctgttgaagaagcacaacgagctataaactctgcctacattgag
gcacatagtgcttatcatggcatcgggattgtaaaactgatgggtcgtaacagtggtttc
attgccatgcaagcctctttagctagcggacaagtcgacatctgtttgattcctgaggtt
cctttcaatattcatggacctaatggtgtactgaagcacttgaagtaccttatcgaaaca
aaaggctccgctgtgatctgtgtagcagaaggagctggacagaatctcctcgagaaaact
aatgcaaaagatgcttctggaaacacgatacttggtgatttcggtgtccacattcaacaa
gagacgaaaaagtactttaaagaagtaagtatgccagtagatgtgaagtacattgatcca
acatacatgattcgagctgtccgtgcaaatgcctcagatggtatcctctgcaccgttctt
ggacaaaacgctgttcatggtgcatttgctggatacagtggcatcacaggaggcataatc
aacactcattacgcgtatttgccaatccctgaagtaattgcgtatccaaagtcagtcgat
cccaatagtcgaatgtggcatcgttgcttgacttcaacaggccaaccagatttcatctaa

KEGG   Brassica napus (rape): 106371466Help
Entry
106371466         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106371466
   00030 Pentose phosphate pathway
    106371466
   00051 Fructose and mannose metabolism
    106371466
   00052 Galactose metabolism
    106371466
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106371466
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106371466
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106371466
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106371466
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106371466
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106371466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106371466
NCBI-ProteinID: XP_013666996
AA seq 488 aa AA seqDB search
MSSPKSNKPKIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSV
PEKIVVHKDGPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLL
EFIEKRIKENGHMVIVLAEGAGQELMSKSMESNTDASGNKLLKDVGLWLSQSIKDYFKKI
NMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPY
YRITEKQNNVVITDRMWARLLSSTNQPSFLGPKDIPEEKKEMPEKPTLDGENCDGVVDIP
PVTKEITK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccaaagagtaacaagccaaagatcgtcaacggtcctggtggttatatacta
caggacgttccccacctcgttgattaccttcctgatcttcctacttacccaaatccatta
caagacaacccagcttactctgttgttaagcagtactttgttgatgcggatgatagtgtt
cctgagaagattgtagtccacaaggatggtccaagaggagtccatttcagacgcgctggt
ccacgccaaaaggtttactttgaatccgacgaagtccatgcttgcattgttacatgtgga
ggtctctgtcctggtctcaacaccgtgattagagagatagtcagcagcttgtcatacatg
tatggagtaaagagaattcttggaatcgatggtggatacaggggattctatgccaagaac
actatccccttaaactccaaagttgtgaacgatatccataaacgcggaggaacgatcctc
gggacctcacgaggtggacatgataccacgaagattgttgatagcatccaagaccgagga
atcaatcaggtttacatcattggtggagatggaacacagagaggagcttcagttatattt
gaggaaattagaaggcgtggactcaaagttgctgtggttggaatccctaaaacaatcgat
aacgacataccagtgatagataaatcttttgggtttgatactgctgtggaggaggctcag
cgagctatcaacgcagcacatgttgaagccgagagtaacgagaatggtatcggtttcgtt
aagcttatgggtcgctacagtggattcatagcgatgtatgctacattagctagcagagat
gttgattgctgtttgattccggagtcaccgttttacctggaaggagaaggtggactgttg
gagttcatagagaaacggataaaggagaatggtcacatggtgattgttcttgctgaagga
gcagggcaagagctgatgtccaaaagcatggaatctaacactgacgcctctggtaacaag
cttcttaaagatgtcggcctgtggctatcacaaagcatcaaggattattttaagaagatt
aatatggtgatgaatctcaaatacatagatcctacatacatgatccgggctgttccgagc
aatgcatcagacaacgtttactgtacacttcttgctcagagcgcggttcatggtgcaatg
gctggttacactggctacaccagtggtcttgtcaatggaagacaaacatacattccttac
tacaggataacagagaagcagaacaatgtggtgattacggatagaatgtgggcaaggctg
ttgtcttctacgaatcagccaagtttcttgggccctaaggatatacctgaggagaagaaa
gagatgccggagaagccaactcttgacggtgaaaactgtgacggagttgtcgatattcct
ccggtgaccaaagagatcactaagtga

KEGG   Brassica napus (rape): 106375323Help
Entry
106375323         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106375323
   00030 Pentose phosphate pathway
    106375323
   00051 Fructose and mannose metabolism
    106375323
   00052 Galactose metabolism
    106375323
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106375323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106375323
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106375323
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106375323
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106375323
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106375323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106375323
NCBI-ProteinID: XP_013670655
AA seq 463 aa AA seqDB search
MDSNGVDEQEMKLVQGAAGYVLEDVPHLSDYILDLPTYPNPLQSNPAYSVVRQYFVDEDD
TVPQKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLH
YMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQD
REINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEE
AQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGG
LYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAK
QRKMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYI
PFNRITEKQNKVVITDRMWARMLSSTNQPSFMNPPNGATEGAN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaatggcgtcgatgagcaggagatgaagttggtgcaaggagctgctggctac
gttctcgaagatgttcctcacttgagtgattacattctcgatctccccacttatccaaac
ccgttgcaatcaaatcccgcttattcagtagtgaggcagtattttgttgatgaggacgat
acagtcccgcaaaagattgttgttcacaaggattctcctagagggacacattttagacgt
gctggaccacgacaaaaggtgtatttcaagccagctgatgtacgggcatgtattgtcaca
tgtggtggtctttgcccgggtcttaatacagtcatcagggagattgtctgtggtcttcac
tacatgtatggtgtcacagaagtacttggtgtcaattgtgggtttagtggattctattcc
aaaaacactgtcactctgacaccgaaggatgttagtgacatccacaagcgcgggggaacc
atgttaggaacatctcgagggggccatgatacatcaaagattgtcgacaacatacaagac
cgtgaaataaaccaggtttacatcattggaggcgatggaacccaaaagggagcatctgca
atatataaggaaattagacgtcgtggacttaaagttgcggtcgcaggaataccaaaaacc
atcgacaatgacatcccagttattgacaagtcgtttggattcgatactgcggttgaggag
gctcaacgtgccatcaatgcagcgcatgttgaagcgacaagtgtggaaaacggcattgga
cttgtcaagctaatgggtcgctacagtgggttcattgcaatgtacgcgactctggccagc
cgggacgttgactgctgtctgattccagagtcacctttttaccttgaaggcaaaggaggg
ctttacgagttcattgcaaaacggctgagagaaaatggccacatggttatagtggttgct
gaaggtgcaggacaagatctagtggccgagagcattgaacagcaagatgcttcggggaac
aagctcctcaaagatgttggactatggatgagtcttaaaatcaaggaacactttgcgaag
cagagaaaaatggacattactctgaaatacattgatccgacatacatgatcagagctatt
ccagccaatgcatctgacaacgtttactctactctcctcgcccaaagcgcagtccatggt
gcaatggcgggttataccggcttcatctctggtcttgttaatggaaggcacacctacatt
cccttcaaccgaataacggaaaaacagaacaaagttgtgattacagacagaatgtgggct
cggatgctgtcatccacgaaccagccaagcttcatgaaccctcctaatggagccacagag
ggggcaaactga

KEGG   Brassica napus (rape): 106375458Help
Entry
106375458         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 1-like isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106375458
   00030 Pentose phosphate pathway
    106375458
   00051 Fructose and mannose metabolism
    106375458
   00052 Galactose metabolism
    106375458
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106375458
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106375458
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106375458
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106375458
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106375458
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106375458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106375458
NCBI-ProteinID: XP_013670828
AA seq 473 aa AA seqDB search
MATSALNSDKKIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDT
VPQKIVVHPDSPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSY
MYGVKKILGIEGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDR
GINQVYIIGGDGSQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEA
QRAINAAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGL
FEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDH
FAKKMTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTY
IPFYRITEKQNKVVITDRMWARLLSSTNQPSFMKHDDNHEPNHSGGEAGAMNW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctctgccttaaactccgacaaaaagatcgtcaccggtccagccggttacgtt
ctcgaagacgttcctcatttctccgattacatcccaaaccctcctacatatccaaatcca
ttacaggacaacgctgcttactctgttgttaagcagtacttcgttgatgaggatgacaca
gttcctcaaaagatagttgttcatcctgatagtccaagaggaacacatttccgcagagca
ggaccacgtcaaagggtttactttgattcggatgatgttgttgcttgcattgtcacatgc
ggtggcttgtgtccagggcttaatactgtgatcagagagattgtttgtggattgtcttac
atgtatggtgtcaagaaaatcctcggaatcgagggaggttacagaggattttatgcaaga
aacacgatcgatttggacttaaaaacagtgaatgatattcataaacgtggaggaaccatc
ctcgggacttcaagaggtggtcatgacactacaaagatagttgatagtattcaagatcgt
gggattaaccaggtttatataattggtggagatggatcacagaaaggagcagctgctata
ttcgaggagattagaagacgtggactcaaagttgctgttgctggtatccccaaaaccatc
gacaatgacattcctattatagatagatcgttcgggtttgacacagctgtagaagaggct
caacgtgctattaacgcagctcatgtggaagctacaagctttgagaatggtattggtctt
gtcaagttaatgggacgttatagtggattcattgcgatgtatgcaacactagcgagcaga
gatgtggactgttgcttgataccggagtctccattttttcttgaaggcaaaggcggtctt
ttcgagtttatcggtaaacggctaaaggagaatggtcacatggtgattgtgatcgcagaa
ggcgctggacaagatctgttggctgaaagcaatgaacagtccacaactctcaaagatgcc
tctggaaacaaactcttacaggacgtgggcctatggatctcccaacggatcaaggatcat
tttgccaagaagatgaccctaaacctcaaatacatagatccaacctacatgataagggct
gttccgagcaatgcatcagacaatgtatgctgcacgctattagctcaaagcgcggttcat
ggagtgatggctggttacaatggcttcaccgttggccttgtcaatggcagacatacttac
attcccttctacaggataacggagaaacagaacaaggtggtgatcactgacagaatgtgg
gcgaggcttttgtcttccacaaaccagccgagtttcatgaagcacgatgataatcacgaa
ccaaaccattccggtggtgaagcaggggctatgaattggtga

KEGG   Brassica napus (rape): 106381271Help
Entry
106381271         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 1-like isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106381271
   00030 Pentose phosphate pathway
    106381271
   00051 Fructose and mannose metabolism
    106381271
   00052 Galactose metabolism
    106381271
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106381271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106381271
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106381271
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106381271
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106381271
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106381271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106381271
NCBI-ProteinID: XP_013676615
AA seq 473 aa AA seqDB search
MATSALNSDKKIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDT
VPQKIVVHPDSPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSY
MYGVKKILGIEGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDR
GINQVYIIGGDGSQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEA
QRAINAAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGL
FEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDH
FAKKMTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTY
IPFYRITEKQNKVVITDRMWARLLSSTNQPSFMKHDDNHEPNHSGGEAGAMNW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctctgccttaaactccgacaaaaagatcgtcaccggtccagccggttacgtt
ctcgaagacgttcctcatttctccgattacatcccaaaccctcctacatatccaaatcca
ttacaggacaacgctgcttactctgttgttaagcagtacttcgttgatgaggatgacaca
gttcctcaaaagatagttgttcatcctgatagtccaagaggaacacatttccgcagagca
ggaccacgtcaaagggtttactttgattcggatgatgttgttgcttgcattgtcacatgc
ggtggcttgtgtccagggcttaatactgtgatcagagagattgtttgtggattgtcttac
atgtatggtgtcaagaaaatcctcggaatcgagggaggttacagaggattttatgcaaga
aacacgatcgatttggacttaaaaacagtgaatgatattcataaacgtggaggaaccatc
ctcgggacttcaagaggtggtcatgacactacaaagatagttgatagtattcaagatcgt
gggattaaccaggtttatataattggtggagatggatcacagaaaggagcagctgctata
ttcgaggagattagaagacgtggactcaaagttgctgttgctggtatccccaaaaccatc
gacaatgacattcctattatagatagatcgttcgggtttgacacagctgtagaagaggct
caacgtgctattaacgcagctcatgtggaagctacaagctttgagaatggtattggtctt
gtcaagttaatgggacgttatagtggattcattgcgatgtatgcaacactagcgagcaga
gatgtggactgttgcttgataccggagtcgccattttttcttgaaggcaaaggcggtctt
ttcgagtttatcggtaaacggctaaaggagaatggtcacatggtgattgtgatcgcagaa
ggcgctggacaagatctgttggctgaaagcaatgaacagtccacaactctcaaagatgcc
tctggaaacaaactcttacaggacgtgggcctatggatctcccaacggatcaaggatcat
tttgccaagaagatgaccctaaacctcaaatacatagatccaacttacatgataagggct
gttccgagcaatgcatcagacaatgtatgctgcacgctattagctcaaagcgcggttcat
ggagtgatggctggttacaatggcttcaccgttggccttgtcaatggcagacatacttac
attcccttctacaggataacggagaaacagaacaaggtggtgatcactgacagaatgtgg
gcgaggcttttgtcttccacaaaccagccgagtttcatgaagcacgatgataatcacgaa
ccaaaccattccggtggtgaagcaggggctatgaattggtga

KEGG   Brassica napus (rape): 106384186Help
Entry
106384186         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106384186
   00030 Pentose phosphate pathway
    106384186
   00051 Fructose and mannose metabolism
    106384186
   00052 Galactose metabolism
    106384186
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106384186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106384186
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106384186
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106384186
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106384186
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106384186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106384186
NCBI-ProteinID: XP_022553616
AA seq 477 aa AA seqDB search
MDVLISSATMCISPKNPLLVRSARPGSLILPKPRSPANSVKFHRVAAVAAARATAIDLSD
PEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCLKMRSPTYINNKDRVLLKVINYSSP
ASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIVTCGGLCPGLNDVIRLIVITL
EIYGVKNIVGIPFGYRGFSDKNLPEIPLSRKVVQNIHLSGGSLLGVSRGGPTVTEIVDSM
EERGINMLFVLGGNGTHAGANAIHNECVKRRMKVAVVGVPKTIDNDILHMDKTFGFDTAV
EEAQRAINSAYIEAHSAYHGIGVVKLMGRSSGFIAMQASLASGQVDICLIPEVPFNFHGP
DGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTNAKDASGNKVLGDIGVHIQQETKKYFK
EIGVAADVKYIDPTYMIRAVRANASDGILCTVLGQNAVKSLYTKTVSTMLKQHLIYI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcttatctcttcggccacgatgtgcatatctcccaagaaccccctcctcgtc
cgttctgcccggcctggttctttgatcctccctaaaccgagatctccagcgaattcggtc
aaatttcatcgagtagcggcggtggcggctgcgagagcaacggctattgatctaagcgat
cccgagtggaaactaaagtatcagagagacttcgaggagagattcaacatccctcatatc
actgatgcgttcccagatgcagaagccatcccttccacgttttgtctcaagatgaggtct
ccgacgtacattaataacaaagatagagtactcctcaaggttataaactactcatcacca
gcttctgctggagcagtgtgtattgatcctgactgcacttggattgagcaatgggttcaa
cgtgctgggccacgggaaaatatttacttcagacctgaggatgtgaaggcagctattgtt
acttgtggtgggctttgtcctggtcttaatgatgtcattaggcttattgtcatcacttta
gagatatatggtgtgaagaacattgttgggattccttttggttaccgtggcttctctgat
aagaacctacctgaaatccctttgtcaagaaaagtggtgcagaacattcatctttccggt
ggaagtttgctcggggtttcacgtggaggaccgactgttactgaaatcgtggacagcatg
gaggagagaggaatcaacatgcttttcgtgcttggtggtaatggaactcatgctggtgcc
aatgctatacacaatgagtgtgtcaaaagaaggatgaaggtagctgtggttggtgtaccg
aaaacaattgacaatgatattttgcatatggataaaacatttgggtttgacactgctgtt
gaagaagcacaacgagctataaactctgcatacatcgaggcacatagtgcttaccatggc
ataggcgttgtgaaactgatgggtcgtagcagtggattcatcgccatgcaagcatcctta
gcgagcggacaagtcgacatttgtctcattcccgaggttcctttcaacttccatggacct
gatggtgtactgaaacatctgaactaccttatcgaaacaaaaggctctgctgtagtttgc
gttgcggaaggagcaggacagagtttccttgagaatacaaatgcaaaagatgcatctgga
aacaaagttctcggtgatatcggtgttcacattcaacaagagacgaagaaatacttcaag
gagattggtgttgcggcagatgtgaagtatatagatccaacatacatgatccgagctgta
cgtgcaaatgcatcagatggaatcctctgcacggtcttaggacaaaacgctgtaaagtct
ttatatactaaaactgtgtctacgatgcttaaacaacatttgatctacatc

KEGG   Brassica napus (rape): 106386063Help
Entry
106386063         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106386063
   00030 Pentose phosphate pathway
    106386063
   00051 Fructose and mannose metabolism
    106386063
   00052 Galactose metabolism
    106386063
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106386063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106386063
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106386063
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106386063
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106386063
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106386063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106386063
NCBI-ProteinID: XP_013681411
AA seq 512 aa AA seqDB search
MDVLISSATMCISPKNPLLVRSARPGSLILPKPRSPANSVKFHRVAAVAAARATAIDLSD
PEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCLKMRSPTYINNKDRVLLKVINYSSP
ASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIVTCGGLCPGLNDVIRLIVITL
EIYGVKNIVGIPFGYRGFSDKNLPEIPLSRKVVQNIHLSGGSLLGVSRGGPTVTEIVDSM
EERGINMLFVLGGNGTHAGANAIHNECVKRRMKVAVVGVPKTIDNDILHMDKTFGFDTAV
EEAQRAINSAYIEAHSAYHGIGVVKLMGRSSGFIAMQASLASGQVDICLIPEVPFNFHGP
DGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTNAKDASGNKVLGDIGVHIQQETKKYFK
EIGVAADVKYIDPTYMIRAVRANASDGILCTVLGQNAVHGAFAGYSGITVGIINNHYAYL
PIPEVIAYDKSVDPNSRMWHRCLTSTGQPDFL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcttatctcttcggccacgatgtgcatatctcccaagaaccccctcctcgtc
cgttctgcccggcctggttctttgatcctccctaaaccgagatctccagcgaattcggtc
aaatttcatcgagtagcggcggtggcggctgcgagagcaacggctattgatctaagcgat
cccgagtggaaactaaagtatcagagagacttcgaggagagattcaacatccctcatatc
actgatgcgttcccagatgcagaagccatcccttccacgttttgtctcaagatgaggtct
ccgacgtacattaataacaaagatagagtactcctcaaggttataaactactcatcacca
gcttctgctggagcagtgtgtattgatcctgactgcacttggattgagcaatgggttcaa
cgtgctgggccacgggaaaatatttacttcagacctgaggatgtgaaggcagctattgtt
acttgtggtgggctttgtcctggtcttaatgatgtcattaggcttattgtcatcacttta
gagatatatggtgtgaagaacattgttgggattccttttggttaccgtggcttctctgat
aagaacctacctgaaatccctttgtcaagaaaagtggtgcagaacattcatctttccggt
ggaagtttgctcggggtttcacgtggaggaccgactgttactgaaatcgtggacagcatg
gaggagagaggaatcaacatgcttttcgtgcttggtggtaatggaactcatgctggtgcc
aatgctatacacaatgagtgtgtcaaaagaaggatgaaggtagctgtggttggtgtaccg
aaaacaattgacaatgatattttgcatatggataaaacatttgggtttgacactgctgtt
gaagaagcacaacgagctataaactctgcatacatcgaggcacatagtgcttaccatggc
ataggcgttgtgaaactgatgggtcgtagcagtggattcatcgccatgcaagcatcctta
gcgagcggacaagtcgacatttgtctcattcccgaggttcctttcaacttccatggacct
gatggtgtactgaaacatctgaactaccttatcgaaacaaaaggctctgctgtagtttgc
gttgcggaaggagcaggacagagtttccttgagaatacaaatgcaaaagatgcatctgga
aacaaagttctcggtgatatcggtgttcacattcaacaagagacgaagaaatacttcaag
gagattggtgttgcggcagatgtgaagtatatagatccaacatacatgatccgagctgta
cgtgcaaatgcatcagatggaatcctctgcacggtcttaggacaaaacgctgttcatggt
gcttttgctgggtacagtggaataactgtggggataataaacaatcattatgcttactta
cccattcctgaagtgattgcttatgacaagtcagttgatcccaatagtcgaatgtggcat
cgttgcttaacttccactggccagcctgattttttgtaa

KEGG   Brassica napus (rape): 106387449Help
Entry
106387449         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106387449
   00030 Pentose phosphate pathway
    106387449
   00051 Fructose and mannose metabolism
    106387449
   00052 Galactose metabolism
    106387449
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106387449
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106387449
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106387449
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106387449
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106387449
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106387449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106387449
NCBI-ProteinID: XP_013682767
AA seq 485 aa AA seqDB search
MSSPKIVNGPGGYTLQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKII
VHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKR
ILGIDGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVY
IIGGDGTQRGASKIFEEIRKRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA
AHVEAESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEK
RLKEHGHMVIVLAEGAGQEMMTKSMESNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMV
MNLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRI
TEKQNSVVITDRMWARLLSSTNQPSFLGPKNISEQKEETHETPSPDGEICNGVVHIPPVT
KEITK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccgaagatcgtcaacggtcccggtggttatacactacaagacgttccccat
ctcatcgattatcttcctgaccttccgacttatcagaatccattaaaagacaatccagct
tactcagtggttaagcaatactttgttgatacagaagatactgtacctgagaagattata
gtccacaaggatggtccaagaggaatccatttcagacgcgcgggtccacgccaaaaggtt
tactttgagtccgatgaagtccatgcatgtattgttacatgtggaggtctctgtcctggc
ctcaataccgtgattagagaaatcgtgagcagcttgtctcacatgtacggagtaaaaaga
atccttggaatcgatggtggatacagaggattctatgcaaagaacactatccccttaacc
tctaaagtcgtgaacgatatccacaaacgaggaggaacaatcttgggaacctcacgaggt
gggcatgataccaaaaagattgttgatagcatccaagagcgaggtatcaaccaggtttat
atcattggtggagacggaacacagagaggagcttcaaaaatatttgaggagattagaaag
cgtggacttaaagttgctgtggttggaataccgaagacgatcgataacgatataccagta
atagatagatcttttgggtttgacactgctgtggaggaggctcaacgagctatcaacgca
gcacatgttgaagctgagagtaatgagaatggtatcggttttgttaagcttatgggtcgt
cacagtggattcatagcgatgtatgcaacattagcaagcagagatgttgattgctgcttg
attccagagtcaccattttacctggaaggagaaggtgggctctttgagtacatagagaaa
cggctcaaggagcatggtcacatggtgattgttcttgctgaaggagcaggacaagaaatg
atgaccaaaagcatggagtctaatactcttgaggacgcgtctggcaacaaggttcttaaa
gatgtcggcttgtggctatcacaaagcatcaaggatcatttcaagaagatcaagatggtg
atgaatctcaaatatattgatcctacatacatgatcagggcgattccaagcaatgcggca
gacaatgtttactgtacacttctagctcagagtgcggttcatggtgcaatggctggttac
actggctacaccagtggtcttgtccatggaagacaaacatacatccctttctacaggata
acggagaaacagaacagtgtggtgattacggatagaatgtgggcaaggctgttgtcttct
actaatcagccaagtttcttgggccctaagaatatatctgagcagaaggaagagacgcac
gagacgccttctcctgacggtgaaatctgtaacggagttgtccatattcctccggtgact
aaagagatcactaagtga

KEGG   Brassica napus (rape): 106396415Help
Entry
106396415         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 1 isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106396415
   00030 Pentose phosphate pathway
    106396415
   00051 Fructose and mannose metabolism
    106396415
   00052 Galactose metabolism
    106396415
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106396415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106396415
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106396415
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106396415
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106396415
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106396415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106396415
NCBI-ProteinID: XP_013692287
AA seq 473 aa AA seqDB search
MATSALNSDKKIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDT
VPQKIVVHPDSPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSY
MYGVKKILGIEGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDR
GINQVYIIGGDGSQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEA
QRAINAAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGL
FEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDH
FAKKMTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTY
IPFYRITEKQNKVVITDRMWARLLSSTNQPSFMKHDDNHEPNHSGGEAGTMNW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctctgccttaaactccgacaaaaagatcgtcaccggtccagccggttacgtt
ctcgaagacgtccctcatttctccgattacatcccaaaccctcctacatatccaaatcca
ttacaggacaacgctgcttactctgttgttaagcagtactttgttgatgaggatgacaca
gttcctcaaaagatagttgttcatcctgatagtccaagaggaacacatttcaggcgagca
ggaccacgtcagagggtttactttgattcggatgatgtagttgcttgcattgttacatgc
ggtggcctgtgtccagggcttaatactgtgatcagagagattgtttgtggattatcttac
atgtatggtgtcaagaaaatcctcggaatcgagggaggttacagaggattctacgcaagg
aacacgatcgatttggacttaaaaacagtgaatgatattcataaacgtggtggaaccatc
ctcgggacttcaagaggtggtcacgacactacaaagatagttgatagtattcaagatcgt
gggattaaccaggtttatataatcggtggagatggatcacagaaaggagctgctgttata
ttcgaggagattaggagacgtggactcaaagttgctgttgctgggatccccaaaacaatc
gacaatgacattcctattatagatagatcgtttgggtttgacacagctgtagaagaggct
caacgtgctattaacgcagctcatgtggaagctacaagctttgagaatggtattggtctt
gtcaagttaatgggacgttatagtgggttcattgcgatgtatgcaacactagcaagcaga
gatgtggactgttgcttgatcccggaatcgccattttttcttgaaggcaaaggcggtctt
ttcgagtttattggcaaacggctaaaggagaatggtcacatggtgattgtgatcgcagaa
ggcgctggacaagatctgttggctgaaagcaatgaacagtccacaactctcaaagatgcc
tctgggaacaagcttctacaggacgtgggcctatggatctcccaaaggatcaaggatcat
tttgccaagaagatgaccctaaacctcaaatacatagatccaacttacatgataagggct
gttccgagcaatgcatcagacaatgtatgctgcacgctattagctcaaagcgcggttcat
ggagtgatggctggttacaatggcttcaccgttggccttgtcaatggcagacatacttac
attcccttctacaggatcactgagaaacagaacaaggtggtgatcactgacagaatgtgg
gcgaggcttttgtcttcaacaaaccagcctagtttcatgaagcacgatgataaccacgag
ccaaaccattcgggtggtgaagcaggtaccatgaattggtga

KEGG   Brassica napus (rape): 106397275Help
Entry
106397275         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106397275
   00030 Pentose phosphate pathway
    106397275
   00051 Fructose and mannose metabolism
    106397275
   00052 Galactose metabolism
    106397275
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106397275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106397275
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106397275
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106397275
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106397275
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106397275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106397275
NCBI-ProteinID: XP_013693311
AA seq 489 aa AA seqDB search
MSTVESSKPKIITGSCGYVLEDVPHLSDYLRALPTYHNPLQDNPAYSVVKQYFVDADDTV
PQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESIENGIGVVKLMGRFSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLF
EYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLKDASGNKLLNDVGLWLSQSIKDHFN
QKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYI
PFYRITEKQNHVVITDRMWARLLSSTNQPSFLSPKDVSDDKEKLMSALLDDGNCNGPVDV
PPVTKEITK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtggaaagtagcaagccgaagatcataactggttcttgtggttatgttctt
gaagacgttcctcatctctccgattatcttcgcgctcttcctacttatcataatccactg
caagacaatccagcttactcagtggttaagcaatactttgttgatgctgatgacactgtc
cctcagaagatcgttgttcacaaggatggtccaagggggattcactttagacgagccggg
ccgcgtcaaaaggtctacttcgaatctgatgaagtccatgcttgcattgtcacctgtggg
ggtctttgtcccggccttaataccgtgattagggaaatcgtgagcagtctctcttatatg
tatggagtgaagagaatactgggaatagatggtggatatagaggcttctatgctaggaat
actgtctccttggactctaaagtcgtaaatgatatccataagcgaggagggaccatcctt
gggacctcacgaggtggtcatgatactacaaagatcgttgacagcattcaagaccgagga
atcaatcaggtttacattataggtggagatggaacacagcgaggcgcatctgttatattt
gaggaagttagaagacgtggcttgaaagttgcagttgttggaatcccaaaaacaatcgat
aatgacatacctgtgatagacaaatcttttgggtttgacacagctgtagaagaggctcaa
cgagctatcaacgcagcacatgtggaagccgagagtatagagaacggtattggtgttgtc
aagcttatgggtcgcttcagcgggttcatagcgatgtacgctactctagcaagcagagac
gtggactgttgtttgattccggagtcaccattttacctggaaggagaaggtggactgttt
gagtacatagagaaacggctcaaggagagtgggcacatggtgcttgtgattgcagaaggt
gcaggacaagatcttatgtcaaagagcatggagtctatgactctcaaagatgcttctggt
aacaaacttcttaacgatgttggtctttggctttcacaaagcatcaaggatcattttaat
cagaagaagatggtgatgaaccttaagtacattgatccaacgtacatgatccgtgctgtt
cctagcaatgcgtcagacaatgtttattgtactcttctggctcagagcgcagtgcacggt
gcgatggctggatacactggctacgtcagtggtctagtgaatggaagacaaacctacatt
cccttctacagaataacggagaaacagaaccatgtggtgatcacagacaggatgtgggcg
aggctgctgtcgtccacaaaccagccgagtttcttgagccctaaagatgtgtctgatgat
aaagagaagctcatgtcggccctcctggacgatggcaactgcaacgggccagtcgatgtt
cctccagtcaccaaagagatcaccaagtga

KEGG   Brassica napus (rape): 106400744Help
Entry
106400744         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 4, chloroplastic isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106400744
   00030 Pentose phosphate pathway
    106400744
   00051 Fructose and mannose metabolism
    106400744
   00052 Galactose metabolism
    106400744
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106400744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106400744
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106400744
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106400744
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106400744
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106400744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106400744
NCBI-ProteinID: XP_022562784
AA seq 537 aa AA seqDB search
MEASISLIGSTTKPNLSSLIIPSSSIVLHPRLPLPALRLKKVSVFPRISHRNRLIRAQCS
DGLRPEEDDGFVLEDVPHLTTFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQ
KGSKRGVHFRRAGPRERVYFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVSNIL
GIQGGYKGFYSKNTMTLTPKVVNDIHKRGGTFLQTSRGGHDTAKIVDNIQDRGINQVYII
GGDGTQKGAEKIYQEVERRGLQVAVSGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH
VEVESVENGVGIVKLMGRYSGEYSCGFIAMIATLANRDVDCCLIPESPFYLEGKGGLFEF
VEQRLKENSHMVIVIAEGAGQDYVAQSMRASETKDASGNRLLLDVGLWLTQQIKDHFTNV
RKMTINMKYIDPTYMIRAIPSNASDNVYCTLLAQSALHGAMAGYSGFTVGPVNSRHAYIP
ISRVTEVTNTVKLTDRMWARLLASTNQPSFLTGAGALQNVIDMETQDKIDNMKISSI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcgatttcgttaattgggtcaactacaaagcctaacctttcatcacttatt
atcccttcttcttccatcgtcctccatcctcgtctccctcttcctgctttgaggctgaag
aaagtctcagtctttcctcgaatctcccaccgtaaccgcctcatcagagctcagtgctca
gatgggttgagaccagaggaagacgatgggtttgtgctagaagacgtccctcacttgaca
accttcctccctgatttgccgtcgtacccaaatccattgaaggaaagccaagcatacgcc
attgttaagcgaacctttgtcagttccgaagatgtggttgcacaaaacattgtagtccag
aagggaagtaagcgaggagtacactttaggcgagcagggcctcgagaaagagtgtacttc
agatcagatgaagtaaaagcttgcatagtgacgtgtgggggcttgtgccctgggattaat
acggttatacgggagattgtatgtggattgaacaatatgtatggagtcagtaatattctc
ggcattcagggaggatataaaggcttttattctaaaaacactatgaccttgacgcctaaa
gtggttaatgatattcataaacgtggtggcacttttcttcaaacctcgagaggaggacat
gatacagccaagattgttgataacattcaagatagaggaataaatcaggtgtatattatt
ggaggtgatgggactcaaaagggtgcagagaagatttaccaggaagtggagaggcgtggg
cttcaggtggcggtttctggcatccccaagacaattgataatgatattgctgtgattgac
aaatcctttgggtttgacactgctgttgaggaagctcagagagctatcaatgctgcacat
gtagaagtggagagcgtggagaatggagttggtattgttaaactcatgggcagatacagc
ggtgaatattcttgtggttttattgcaatgattgcaactttagcgaaccgtgatgtggat
tgttgcctgattccagagtctccattctaccttgaaggaaaaggtgggctgtttgagttt
gtagaacaacgactcaaagagaatagccacatggttattgtgatagccgaaggagctggg
caggactatgttgctcaaagcatgcgtgcttctgaaactaaagatgcgtcaggaaataga
ctcttgcttgatgttggtctgtggttgactcaacagattaaggatcatttcacaaatgtt
cggaaaatgactataaacatgaagtacatagatccgacgtatatgataagagcaattccg
agtaacgcgtcagataatgtctattgcactcttcttgctcaaagtgcacttcatggagca
atggctgggtactcaggtttcaccgttggaccagttaacagcagacatgcttacatccct
atttctcgagtgacagaagtgaccaatacggtgaagttaacggataggatgtgggctaga
cttcttgcatcaacaaatcaaccgagtttcttgactggtgcaggagcgttgcagaatgtg
atcgacatggaaactcaagataagattgataacatgaagatctcttctatctag

KEGG   Brassica napus (rape): 106401306Help
Entry
106401306         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106401306
   00030 Pentose phosphate pathway
    106401306
   00051 Fructose and mannose metabolism
    106401306
   00052 Galactose metabolism
    106401306
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106401306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106401306
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106401306
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106401306
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106401306
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106401306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106401306
NCBI-ProteinID: XP_013697256
UniProt: A0A078FZE1
AA seq 444 aa AA seqDB search
MANATSIKDLPSLTGLHHRRNPLEENPFFHPSHGFYISPSDVVLSQVVYDLSDASQPHVA
YHRAGPRREILYEPSSVKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRG
FYSMEAVELNPKLVHNWHKRGGTVLATSRGGFDLCKIVDAIQQNGYNQVYIIGGDGTMRG
AVKIFDEVSRRKLKVGITGIPKTVDNDVGIIDRSFGFQTAVEMAQEAISAAHVEAESAVN
GIGLVKLMGRSTGHIALHATLSSRDVDCCLIPEMGFYLEGKGGLFEFLEQRLKDHGHAVL
VVAEGAGQEIIPRNEAQKQERDESGNLVFLDVGVWLKSALKEWWEREHPKELFTVKYIDP
TYMIRAVPANATDNSYCTLLAHSSIHGVMAGYTGFVSGPINGNYAYIPLEEVAQTKNEVN
TSDPKWAWVRSVTNQPDFETNFKG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcaaccagtatcaaagacctcccatctctcaccggcctccatcaccgccgc
aacccgctagaagaaaaccccttcttccacccttcccacggcttctacatctctccttcc
gacgtcgtcctctcccaggtcgtctacgacctctccgacgcctcccagccacacgtggcc
taccacagagctggtccccgccgtgagatcctctacgagccatcgtctgtgaaggcggcg
atcgtgacctgcggaggtttgtgcccggggatgaacaccgtcatcagagagctcgtggtt
ggtctttgggagctgtacggtgtgagagagatctatggaatcccagctggttacagaggc
ttttactccatggaagccgtcgagttaaaccccaagcttgttcataattggcacaagaga
ggcggcactgtcctcgccacctcccgcggtggctttgatctctgtaaaatcgtcgacgcc
atccaacaaaacggttacaaccaggtctatataataggaggagacggcactatgcgtggg
gcagtcaagatcttcgacgaagtcagccgcaggaaactgaaagtggggatcactggtatt
cccaaaacggtggacaacgatgtgggcatcattgatagatcattcgggtttcaaacggca
gtagagatggctcaggaggctatatccgcggctcacgtggaggctgagagcgctgtcaat
ggcatcggactagtgaagcttatgggcagaagcactggacacattgcgctacatgccaca
ctaagcagccgtgacgtggactgttgtttgatccctgagatgggattctaccttgaaggc
aaaggagggttgtttgagtttctggagcagagactgaaagatcatgggcatgctgtactt
gttgtagctgaaggcgctggacaagagattatcccgaggaacgaagcgcagaaacaagag
agggatgaatctgggaaccttgttttcttggatgttggagtttggttgaagtcagcgctg
aaggagtggtgggagagagagcatccaaaggagctgttcactgtgaagtatatcgatcca
acttacatgataagagctgtacctgcgaatgctacggataactcgtactgtacgctcttg
gctcactcgtctatccatggagtcatggctggttacacggggtttgtgtctggcccgatc
aatgggaactatgcttatatccccttggaggaggtggcacagactaagaatgaagtgaac
acgagtgatcccaagtgggcgtgggtacgctctgtcacaaaccagcctgattttgaaact
aacttcaaggggtaa

KEGG   Brassica napus (rape): 106410347Help
Entry
106410347         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106410347
   00030 Pentose phosphate pathway
    106410347
   00051 Fructose and mannose metabolism
    106410347
   00052 Galactose metabolism
    106410347
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106410347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106410347
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106410347
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106410347
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106410347
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106410347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106410347
NCBI-ProteinID: XP_013706293
AA seq 444 aa AA seqDB search
MADATSIKELPSLTGLHQRRNPLEENPFFHPSHGFYITPSDVVLSQVVYDLSDASQPHVA
YHRAGPRREILYEPSSVKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRG
FYSMEAVELNPKLVHNWHKKGGTVLATSRGGFDLCKIVDAIQQNGYNQVYIIGGDGTMRG
AVKIFDEVSRRKLEVGITGIPKTVDNDVGIIDRSFGFQTAVEMAQEAISAAHVEAESAVN
GIGLVKLMGRSTGHIALHATLSSRDVDCCLIPEMGFYLEGKGGLFEFLEQRLKDHGHAVL
VVAEGAGQEMIPRTEAQKQERDESGNLVFLDVGVWLKSALKEWWEREHPKELFTVKYIDP
TYMIRAVPANATDNLYCTLLAHSSIHGVMAGYTGFVSGPINGNYAYIPLEEVAQTKNEVN
TSDPKWAWVRSVTNQPDFETNFKG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaaccagtatcaaagaactcccatctctcaccggtctccaccaacgccgc
aacccactggaagaaaaccccttcttccacccttcccatggcttctacatcactccttcc
gacgtcgtcctctcccaggtcgtttacgatctctccgacgcctcccagccacacgtggcc
taccacagagctggtccccgccgagagatcctctacgagccatcgtctgtgaaggcggcg
atcgtaacatgcggaggtctgtgtccggggatgaacaccgtcatcagagagctcgtggtt
ggtttgtgggagctgtacggtgtgagagagatctatggaatcccagctggttacagaggc
ttttactccatggaagccgtcgagttaaaccctaagcttgttcataattggcacaagaaa
ggcggcactgtcctcgccacctcccgcggtggcttcgatctctgtaaaatcgtcgacgcc
atccaacaaaacggttataaccaggtctatataataggaggagacggcactatgcgcggg
gcagtcaagatcttcgacgaagtcagccgcaggaaacttgaagtgggaatcactggtatt
cccaaaacggttgacaacgatgtgggcatcattgatagatcattcgggtttcaaacggca
gtagagatggctcaggaggctatatccgcggctcacgtggaggctgagagcgctgtcaat
ggcatcggactagtgaagcttatgggcagaagcactggacacattgcgctacatgccaca
ctaagcagccgtgacgtggactgttgtttgatccctgagatgggattctaccttgaaggc
aaaggagggttgtttgagtttctggagcagagactgaaagatcatgggcatgctgttctt
gttgtggctgaaggcgctggacaagagatgatcccgagaactgaagcgcagaaacaagag
agggatgaatctgggaaccttgttttcttggatgttggagtttggttgaagtcagcgctg
aaggagtggtgggagagagagcatccaaaggagctgttcactgtgaagtatatcgatccc
acttacatgataagagctgtacctgcgaatgctacggataacttgtactgtacgctcttg
gctcactcgtctatccatggagtcatggctggttacacagggtttgtgtctggtccgatc
aatgggaactatgcttatatccccttagaggaggtggcacagactaagaatgaagtgaac
acgagtgatcccaagtgggcatgggtgcgctctgtcacaaaccagccagattttgaaacg
aatttcaaggggtaa

KEGG   Brassica napus (rape): 106415835Help
Entry
106415835         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106415835
   00030 Pentose phosphate pathway
    106415835
   00051 Fructose and mannose metabolism
    106415835
   00052 Galactose metabolism
    106415835
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106415835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106415835
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106415835
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106415835
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106415835
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106415835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106415835
NCBI-ProteinID: XP_013712086
AA seq 539 aa AA seqDB search
METLSPPIITSTVSIPYSNGSVLVRSHGLSSLILRKPRSPAANPSLISSRSSFNRASAVE
HGKTSVSIDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRSTFCLKMRSPTEDFVGG
YPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDSDCSWVEQWIHRAGPREKIYFRPE
QVKAAIITCGGLCPGLNDVIRHIVITLEIYGVKNIVGIPFGYKGFSDKDLTEMPLSRKVV
QNIHLSGGSLLGVSRGGPSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHDECRKRKMK
VAVVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGIVKLMGRNSGF
IAMQASLASGQVDICLIPEVPFNIHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKT
NAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILCTVL
GQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaaactctctctccgcctatcatcacctccaccgtctcgattccttacagcaacggc
tctgtcctcgtaaggtctcacggtctcagctctttaatcctccggaaaccgagatctccg
gcggcgaatccctcgctgatctcctctcgcagctctttcaatcgagcttcagcggttgaa
cacggcaaaacctcggtttcgatcgatctcagcgatccgaattggaaaagaaagtacgag
agagagttcgaggaaagattcagcatccctcacatcactgacgtcttcccagatgcagaa
gctatccgttctacgttttgtctcaagatgaggtctccgacggaagattttgtgggtggg
tacccatctgatgaagaatggcatggatacattaataacaatgatagggttcttctcaag
gttattagttattcttcaccaacttctgctggagctgagtgcattgattccgactgttct
tgggttgagcaatggattcaccgtgctgggccgagggagaagatatacttcagaccggaa
caagtgaaggctgccatcatcacttgtggtgggctttgtcctggtctcaatgatgtcatc
agacatattgtcatcactcttgagatttatggtgttaagaacattgttgggattcctttt
ggttacaaaggcttctctgataaagatctaaccgaaatgccgttatcaaggaaagtggta
cagaacattcatctatctggaggaagcttgcttggagtttcacgtggaggtcctagtgtg
agcgagattgttgacagcatggaggagagaggaatcaacatgctttttgtgcttggtgga
aacggcactcatgctggcgccaacgctatccacgatgagtgccgcaaaagaaagatgaag
gtagctgtagttggtgtgccaaagaccattgacaatgatatattgcacatggataagaca
tttgggtttgatactgctgttgaagaagcacaacgagctataaactctgcctacattgag
gcacatagcgcttatcatggcattggcatagtgaaactgatgggtcgtaacagtggtttc
attgccatgcaagcctctttagctagcggacaagtagacatctgtttgattcctgaggtt
cctttcaatattcatggacctaatggtgtactgaaacacttgaagtaccttatcgaaaca
aaaggctccgctgtgatctgtgtagcagaaggagctggacagaatctcctcgagaaaact
aatgcaaaagatgcatctggaaacacgatacttggtgatttcggtgtccacattcaacaa
gagacgaaaaagtactttaaagaagtaagtatgccagtagatgtgaagtacattgatcca
acatacatgattcgagctgtccgtgcaaatgcctcagatggtatcctctgcaccgttctt
ggacaaaacgctgttcatggtgcatttgctggatacagtggcatcacagtaggcataatc
aacactcattacgcgtatttgccaatccctgaagtaattgcttatccaaagtcggtcgat
cccaatagtcgaatgtggcatcgttgcttgacatcaactggtcaaccagatttcatctaa

KEGG   Brassica napus (rape): 106418226Help
Entry
106418226         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106418226
   00030 Pentose phosphate pathway
    106418226
   00051 Fructose and mannose metabolism
    106418226
   00052 Galactose metabolism
    106418226
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106418226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106418226
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106418226
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106418226
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106418226
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106418226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106418226
NCBI-ProteinID: XP_013714346
AA seq 490 aa AA seqDB search
MTSPKRNKAKIVNGPGGYILQDVPHLIDYLPDLPAYPNPLQDNPAYSVVKQYFVDADDSV
PEKIVVHKDGPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCM
YGVNRILGIDGGYRGFYAKNTISLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQ
RAINAAHVEAESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLL
EFIERRLKENGHMVIVLAEGAGQDLMSKSMESNTLEDASGNKLLKDVGLWLSQSIKDHFK
KNKMEMNLKYIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYI
PYYRITEKQNHVVITDRMWARLLSSTNQPSFLGPKDIPEEKKELPVTPLPDGEKCDAVVD
IPPVTKEVTK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactagtccgaagagaaacaaggcgaagatcgtcaatggtcctggtggttatatacta
caggacgttcctcatctcattgattatcttcctgatcttcctgcatatccgaatccatta
caagacaatccagcttactcagttgttaagcaatactttgttgatgcagatgatagtgtt
cctgagaagattgtagtccacaaggatggtccaagaggaatccatttcagacgcgccggt
ccacgccaaaaggtttacttcgactccgacgaagtccacgcttgcattgtcacatgtgga
ggtctctgtcccggtctcaacaccgtcattagagaaatcgtcagcagcttatcatgcatg
tacggtgtaaacagaatcctcggaatcgatggtggatacagaggattctacgccaagaac
actatctccttagactccaaagtcgtcaacgacatccacaaacgcggaggaacaatcctc
gggacctctcgaggtggacacgataccgcaaagatagttgatagcatccaagaccgagga
atcaatcaggtttacattattggtggagacggaacacagagaggagcttcagtaatcttt
gaggagattagaaggcgtggacttaaagttgctgtggttggaatccctaaaacaatcgat
aacgacataccggtgatagatagatcttttgggtttgatactgctgtggaggaagctcag
agagctatcaacgcagcacatgttgaagctgagagtaatgagaatggtattggttttgtt
aagctcatgggtcgttacagtggattcatagcgatgtatgctacattagcaagcagagat
gtggattgctgtttgattccggagtcaccgttttaccttgaaggagaaggtggactgttg
gagtttatagagagacggcttaaggagaatggtcacatggtgattgttcttgctgaagga
gcgggacaagatttgatgtctaaaagcatggagtctaatactcttgaggatgcgtctggt
aacaagcttcttaaagatgttggcttgtggctatcacaaagcatcaaggatcatttcaag
aagaataagatggagatgaatctcaaatacatagaccctacatacatgatccgggctgtt
ccgagcaatgcatcagacaatgtttactgttcacttcttgctcaaagtgcggttcacggt
gcaatggctggatacactggctacacaagtggtcttgtcaatggaagacagacatacatc
ccttactacagaataacagaaaaacagaaccatgtggtgattactgatagaatgtgggca
aggctgttgtcttctacaaatcagccaagcttcttgggccctaaggatatacctgaggag
aagaaagagcttccggtgacgccacttcctgacggcgaaaagtgtgacgcagttgtggat
attcctccggtgactaaagaggtcaccaagtga

KEGG   Brassica napus (rape): 106429174Help
Entry
106429174         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106429174
   00030 Pentose phosphate pathway
    106429174
   00051 Fructose and mannose metabolism
    106429174
   00052 Galactose metabolism
    106429174
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106429174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106429174
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106429174
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106429174
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106429174
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106429174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106429174
NCBI-ProteinID: XP_013725366
UniProt: A0A078HTA9
AA seq 485 aa AA seqDB search
MTSPKRNKAKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSV
PEKIVVHKDGPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCM
YSVNRILGIDGGYRGFYAKNTIPLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSILDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQ
RAINAAHVEAESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLL
EFIERRLKENGHMVIVLAEGAGQDLMSKRMESNTLEDASGNKLLKDVGLWLSQSIKDHFK
KNKMVMNLKYIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYI
PYYRITEKQNHVVITDRMWARLLSSTNQPSFLGPKDIPEEKKELPVTPLPDGIVDIPPVT
KEITK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactagtccgaagagaaacaaggcgaagatcgtcaatggtcctggtggttatatacta
caggacgttcctcatctcattgattatcttcctgatcttcctacatatccgaatccatta
caagacaatccagcttactcagttgttaagcaatactttgttgatgcagatgatagtgtt
cctgagaagattgtagtgcacaaggatggtccaagaggaatccatttcagacgcgccggt
ccacgccaaaaggtttacttcgactccgacgaagtccacgcttgcattgtcacatgtgga
ggtctctgtcccggtctcaacaccgtcattagagaaatcgtcagcagcttatcatgcatg
tacagtgtaaacagaatcctcggaatcgatggtggatacagaggattctacgccaagaac
actatccccttagactccaaagtcgtaaacgacatccacaaacgcggaggaacaatcctc
gggacctctcgaggtggacatgataccgcgaagatagttgatagcatcctagaccgagga
atcaatcaggtttacattattggcggagacggaacacagagaggagcttcagtaatcttt
gaggagattagaaggcgtggactcaaagttgctgtggttggaatcccgaagacaatcgat
aacgatataccggtgatagatagatcttttgggtttgatactgctgtggaggaagctcag
cgagctatcaacgcagcacatgttgaagctgagagtaatgagaatggtattggttttgtt
aagcttatgggtcgttacagtgggttcatagcgatgtatgctacattagctagcagagat
gtggattgctgtttgattccggagtcaccgttttaccttgaaggggaaggtgggctgttg
gagtttatagagagaaggcttaaggagaatgggcacatggtgattgttcttgctgaagga
gcaggacaagatttgatgtctaaaagaatggagtctaatactcttgaggatgcgtctggt
aacaagcttcttaaagatgttggcttgtggctatcacaaagcatcaaggatcatttcaag
aagaataagatggtgatgaatctcaaatacatagatcctacatacatgatccgagctgtt
ccaagcaatgcatcagacaatgtttactgttcacttcttgctcaaagtgcggttcacggt
gcaatggctggatacactggctacacaagtggtcttgtcaatggaagacagacatacatc
ccttactacagaataacagagaaacagaaccatgtggtgattacggatagaatgtgggca
aggctattgtcttctacgaatcagccaagtttcttgggccctaaggatatacctgaggag
aagaaagagctgccggtgacgccacttcctgacggaattgtggatattcccccggtgact
aaagagatcactaagtga

KEGG   Brassica napus (rape): 106432840Help
Entry
106432840         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106432840
   00030 Pentose phosphate pathway
    106432840
   00051 Fructose and mannose metabolism
    106432840
   00052 Galactose metabolism
    106432840
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106432840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106432840
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106432840
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106432840
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106432840
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106432840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106432840
NCBI-ProteinID: XP_013729138
UniProt: A0A078H7L8
AA seq 488 aa AA seqDB search
MSNPKSNKPKIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSV
PEKIVVHKDGPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLL
EFIEKRIKENGHMVIVLAEGAGQELMSKSMESNTDASGNKLLKDVGLWLSQSIKDYFKKI
NMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPY
YRITEKQNNVVITDRMWARLLSSTNQPSFLGPKDIPEEKKEMPEKSTLDGENCDGVVDIP
PVTKEITK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatccaaagagtaacaagccaaagatcgtcaacggtcctggtggttatatacta
caggatgttcctcatctcgttgattaccttcctgatcttcctacttacccaaatccatta
caagacaacccagcttactctgttgttaagcagtactttgttgatgcggatgatagtgtt
cctgagaagattgtagtccacaaggatggtccaagaggagtccatttcagacgcgctggc
ccgcgccaaaaggtttactttgagtccgatgaagtccacgcttgcatcgtcacatgtgga
ggtctctgtcctggtctcaacaccgtaattagagagatagtgagcagcttgtcatacatg
tatggagtaaagagaattcttggaatcgatggtggatacaggggattctatgccaagaac
actatccccttaaactccaaagttgtgaacgatatccataaacgcggaggaacgatcctc
gggacctcacgaggtggacatgataccacgaagattgttgatagcatccaagaccgagga
atcaatcaggtttacatcattggtggagatggaacacagagaggagcttcagttatattt
gaggaaattagaaggcgtggactcaaagttgctgtggttggaatccctaaaacaatcgat
aacgacataccagtgatagataaatcttttgggtttgatactgctgtggaggaggctcag
cgagctatcaacgcagcacatgttgaagccgagagtaacgagaatggtatcggtttcgtt
aagcttatgggtcgctacagtggattcatagcgatgtatgctacattagctagcagagat
gtcgattgctgtttgattcccgagtcaccgttttacctggaaggagaaggtggactgttg
gagttcattgagaaacggatcaaggagaatggtcacatggtgattgttcttgctgaagga
gcagggcaagagttgatgtccaaaagcatggaatccaacactgacgcctctggtaacaag
cttcttaaagatgtcggcttgtggctatcccaaagcatcaaggattattttaagaagatt
aatatggtgatgaatctcaaatacatagatcctacatacatgatccgggctgttccaagc
aatgcatcagacaacgtttactgtacacttcttgctcagagcgcggttcatggtgcaatg
gccggttacactggctacaccagtggtcttgtcaatggaagacaaacatacattccttac
tacaggataacagagaagcagaacaatgtggtgattacggatagaatgtgggcaaggctg
ttgtcttctacgaatcaaccaagtttcttgggccctaaggatatacctgaggagaagaaa
gagatgccggagaagtcaactcttgacggcgaaaactgtgacggagttgtcgatattcct
ccggtgactaaagagatcactaagtga

KEGG   Brassica napus (rape): 106436268Help
Entry
106436268         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106436268
   00030 Pentose phosphate pathway
    106436268
   00051 Fructose and mannose metabolism
    106436268
   00052 Galactose metabolism
    106436268
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106436268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106436268
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106436268
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106436268
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106436268
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106436268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106436268
NCBI-ProteinID: XP_013732681
AA seq 485 aa AA seqDB search
MSSPKIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKII
VHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKR
ILGIDGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVY
IIGGDGTQRGASKIFEEIRKRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA
AHVEAESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEK
RLKEHGHMVIVLAEGAGQEMMTKSMESTTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMV
MNLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRI
TEKQNSVVITDRMWARLLSSTNQLSFLGPKNISEQKKETHETPSPDSEICNGVVHIPPVT
KEITK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccgaagatcgtcaacggtcccggtggttatatactacaagacgttcctcat
ctcatcgattatcttcctgatcttcctacttatcagaatccattaaaagacaatccagct
tactcagtggttaagcaatactttgttgatacagaggatactgtacctgagaagattata
gtccacaaggatggtccaagaggaatccatttcagacgcgctggtccacgccaaaaggtt
tactttgagtcagatgaagtccatgcttgtattgttacatgtggaggtctctgtcctggc
ctcaataccgtgattagagaaattgtgagcagcttgtctcacatgtacggagtaaaaaga
atccttggaatcgatggtggatacagaggattctatgcaaagaacactatccccttaacc
tctaaagtcgtgaacgatatccacaaacgaggaggaacaatcttgggaacctcacgaggt
gggcatgataccaaaaagattgttgatagcatccaagagcgaggtatcaaccaggtttat
atcattggtggagacggaacacagagaggagcttcgaagatatttgaggagatcagaaag
cgtggacttaaagttgctgtggttggaatcccgaagacgatcgataacgacataccagta
atagatagatcttttgggtttgacactgctgtggaggaagctcagcgagcgatcaacgca
gcacatgttgaagctgagagtaatgagaatggtatcggttttgttaagcttatgggtcgt
cacagtggttttatagcgatgtatgctacgttagcaagcagagatgttgattgctgcttg
attccagagtcaccattttacctggaaggagaaggtggactctttgagtacatagagaaa
aggctcaaggagcatggtcacatggtgattgttcttgccgaaggagcaggacaagaaatg
atgaccaaaagcatggagtctactactcttgaggacgcgtctggtaacaaggttcttaaa
gatgtcggcttgtggctatcacaaagcatcaaggatcatttcaagaagatcaagatggtg
atgaatctcaaatatattgatcctacatacatgatcagggcgattccaagcaatgcggca
gacaatgtttactgtacacttctagctcagagcgcggttcatggtgcaatggctggttac
actggctacaccagtggtcttgtccatggaagacaaacatacatccctttctacaggata
acagagaaacagaacagtgtggtgattaccgatagaatgtgggcaaggctgttgtcttct
actaatcagctaagtttcttgggccctaagaatatatctgagcagaagaaagagacgcac
gagacgccttctcctgacagtgaaatctgtaacggagttgtccatattcctcctgtgact
aaagagatcactaagtga

KEGG   Brassica napus (rape): 106444275Help
Entry
106444275         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3 isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106444275
   00030 Pentose phosphate pathway
    106444275
   00051 Fructose and mannose metabolism
    106444275
   00052 Galactose metabolism
    106444275
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106444275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106444275
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106444275
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106444275
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106444275
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106444275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106444275
NCBI-ProteinID: XP_013741224
AA seq 490 aa AA seqDB search
MSTVESSKPKIITGSCGYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTV
PQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLF
AYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLKDASGNKLLNDVGLWLSQSIKDHFN
QKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYI
PFYRITEKQNHVVITDRMWARLLSSTNQPSFLSPKDVSDDKEKPMSALLDDGNCNGPVDV
PPPVTKEITK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtggagagcagcaagccgaagatcataactggttcttgtggttatgttctt
gaagacgttccccatctctccgattaccttcccggtcttcctacttatcataatccattg
caagacaatccagcttactctgtggttaagcaatactttgttgatgctgatgacactgtc
cctcagaagatcgttgttcacaaggatggtccaaggggcattcactttagacgagccggg
ccacgtcaaaaggtctacttcgaatctgatgaagtccatgcttgcattgttacctgtggg
ggtctttgtcccggccttaataccgtgattagggaaatcgtgagcagtctctcttacatg
tatggagtgaagagaatattgggaatagatggtggatatagaggcttctatgctaggaat
actgtctccttggactccaaagtcgttaatgatatccataagcgaggagggaccatcctt
gggacctcacgaggtggtcatgatactacaaagatcgttgacagcattcaagaccgagga
atcaatcaggtttacattataggtggagatggaacacagcgaggcgcatccgttatattt
gaggaagttagaagacgtggcctgaaagttgcagttgttggaatcccaaaaacaatcgat
aatgacatacctgtgatagacaaatcttttgggtttgacacagctgtagaagaagctcaa
cgagctatcaacgcagcacatgtggaagccgagagtatagagaacggtattggtgttgtc
aagcttatgggtcgctacagcgggttcatagcgatgtacgctactctagcgagcagagat
gtggactgttgtttgattccggagtcaccattttacttggaaggagaaggcggactgttt
gcgtacatagagaaacggctcaaggagagcggtcacatggtgcttgtgattgcagaaggt
gcagggcaagatcttatgtcaaagagcatggagtctatgactctcaaagatgcttctggt
aacaaacttcttaacgatgttggtctttggctttcacaaagcatcaaggatcattttaat
cagaagaagatggtgatgaaccttaagtacattgatccaacgtacatgattcgtgctgtt
cctagcaatgcgtcagacaatgtttattgtacgcttctggctcagagcgcagttcacggt
gcgatggctggatacactggctacgtcagtggtctagtgaatggaagacaaacctacatt
cccttctacagaataacggagaaacagaaccatgtggtgatcacagacaggatgtgggcg
aggctgctgtcgtccacaaaccagccgagtttcttgagccccaaagatgtgtctgatgat
aaagagaagcccatgtcggccctcctggacgatggcaactgcaacgggccagtcgatgtt
cctcctccagtcaccaaagagatcaccaagtga

KEGG   Brassica napus (rape): 111214456Help
Entry
111214456         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3 isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111214456
   00030 Pentose phosphate pathway
    111214456
   00051 Fructose and mannose metabolism
    111214456
   00052 Galactose metabolism
    111214456
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111214456
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    111214456
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    111214456
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111214456
Protein phosphatases and associated proteins [BR:bna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111214456
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111214456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 111214456
NCBI-ProteinID: XP_022573055
AA seq 514 aa AA seqDB search
MSTVESSKPKIITGSCGYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTV
PQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDVSFHLDTFTLLFVSFSLRLNLFFQGGYRGFYARNTVSLDSKVVNDIHKRG
GTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEVRRRGLKVAVVGIP
KTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATL
ASRDVDCCLIPESPFYLEGEGGLFAYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLK
DASGNKLLNDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQS
AVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSFLSPKD
VSDDKEKPMSALLDDGNCNGPVDVPPPVTKEITK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtggagagcagcaagccgaagatcataactggttcttgtggttatgttctt
gaagacgttccccatctctccgattaccttcccggtcttcctacttatcataatccattg
caagacaatccagcttactctgtggttaagcaatactttgttgatgctgatgacactgtc
cctcagaagatcgttgttcacaaggatggtccaaggggcattcactttagacgagccggg
ccacgtcaaaaggtctacttcgaatctgatgaagtccatgcttgcattgttacctgtggg
ggtctttgtcccggccttaataccgtgattagggaaatcgtgagcagtctctcttacatg
tatggagtgaagagaatattgggaatagatgtaagttttcatctagacacattcacgctc
ttgtttgtctcattttctctaagattgaatcttttttttcagggtggatatagaggcttc
tatgctaggaatactgtctccttggactccaaagtcgttaatgatatccataagcgagga
gggaccatccttgggacctcacgaggtggtcatgatactacaaagatcgttgacagcatt
caagaccgaggaatcaatcaggtttacattataggtggagatggaacacagcgaggcgca
tccgttatatttgaggaagttagaagacgtggcctgaaagttgcagttgttggaatccca
aaaacaatcgataatgacatacctgtgatagacaaatcttttgggtttgacacagctgta
gaagaagctcaacgagctatcaacgcagcacatgtggaagccgagagtatagagaacggt
attggtgttgtcaagcttatgggtcgctacagcgggttcatagcgatgtacgctactcta
gcgagcagagatgtggactgttgtttgattccggagtcaccattttacttggaaggagaa
ggcggactgtttgcgtacatagagaaacggctcaaggagagcggtcacatggtgcttgtg
attgcagaaggtgcagggcaagatcttatgtcaaagagcatggagtctatgactctcaaa
gatgcttctggtaacaaacttcttaacgatgttggtctttggctttcacaaagcatcaag
gatcattttaatcagaagaagatggtgatgaaccttaagtacattgatccaacgtacatg
attcgtgctgttcctagcaatgcgtcagacaatgtttattgtacgcttctggctcagagc
gcagttcacggtgcgatggctggatacactggctacgtcagtggtctagtgaatggaaga
caaacctacattcccttctacagaataacggagaaacagaaccatgtggtgatcacagac
aggatgtgggcgaggctgctgtcgtccacaaaccagccgagtttcttgagccccaaagat
gtgtctgatgataaagagaagcccatgtcggccctcctggacgatggcaactgcaacggg
ccagtcgatgttcctcctccagtcaccaaagagatcaccaagtga

DBGET integrated database retrieval system