KEGG   Brassica napus (rape): 106360538Help
Entry
106360538         CDS       T04128                                 

Definition
(RefSeq) putative 3,4-dihydroxy-2-butanone kinase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00561  Glycerolipid metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106360538
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106360538
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     106360538
    2.7.1.29  glycerone kinase
     106360538
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     106360538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2 DUF3994
Motif
Other DBs
NCBI-GeneID: 106360538
NCBI-ProteinID: XP_013655602
AA seq 594 aa AA seqDB search
MAPPAKKFINNPNDVVTEFIEGLVETYPGLQYLDGLPEVKVVLRADVSAADYDKVAVISG
GGSGHEPAQAGYVGEGMLTAAICGDVFASPPVYSIIAGIRAVTGPMGCLLVVTNYTGDRL
NFGLAAELAKTEGFKVETVIVGDDCALPPPRGISGRRGLAGTVLVHKVAGAAAAAGLSLE
EVAAEAKHASEMVGTMGVALTVCSLPGQATSDRLGPEKMELGLGVHGEPGAAVVDIQPVD
VVVSHVLQQILSPETNYVPITRGNSVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAV
DRVYTGSFMSSLDMAGFSISIMKADQSILERLDAPTKGPSWPVGTDGNRPPSKIPVPLPP
FQQNKNEESLGRPQELSQQGRILEAAIKAAATVVISLKDSLNEWDGKVGDGDCGSTMCRG
ATAILEDMKNYYPLNDAAETVNEIGSSIRRVMGGTSGIIYSLLCKAAYAELKANAQSEVT
PKNWSDALKSSISAVSKYGGASAGYRTMLDALIPASKVLEEKLSVGEDPVSAFVLSAEAA
TAGAESTIQMQAQAGRSSYVSAEILASIPDPGAMAAAAWYSAAARAVKEQSQGL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctcctccagctaagaaattcatcaacaaccccaacgatgtagtaacagagttcata
gagggtctggtcgaaacttatcctggacttcagtacttggatggcctccctgaggtcaag
gttgtactacgagctgatgtctcggctgcagattatgacaaggttgctgttatatcagga
gggggaagtgggcatgaaccagcacaagctggatacgtgggagaaggaatgctaaccgca
gctatttgcggtgatgtctttgcttcaccaccggtttattccatcatagctgggattcga
gctgtaactggtccaatgggatgcctcttggttgtcacgaactatactggtgaccgcttg
aactttggcctagctgctgagctagctaaaactgagggtttcaaagtagagactgtgatt
gttggagatgactgtgctctcccaccgccacgtggcatatctggacgcagaggtttagca
ggaacagttcttgtccataaggtagctggagcagcagcagcagctggtctttccttagaa
gaagttgcggcagaagcaaagcatgcttctgagatggtagggaccatgggagttgcactg
actgtttgttcgcttccgggacaggctacatcagatcgtttgggtcctgagaaaatggaa
cttgggcttggtgttcatggggaacctggtgctgctgtggtcgacattcaacctgtggat
gttgtagtctcccatgttcttcaacagatactgagtccagagactaattatgttccaatt
acacgtggtaacagtgtggttctgatggttaatggcttaggtggtaccccactaatggaa
cttatgattgctgctggaaaagcagtccctaaactacagttggaatttggacttgccgtt
gatagggtgtatactggatcttttatgtcatctcttgatatggcaggtttctcgatatcg
atcatgaaggctgaccagtcaattttagagcgtctggatgctccgaccaagggacctagt
tggccagttggcacagatgggaaccgcccaccatcgaagatcccagttccactgcctcca
ttccaacaaaacaaaaacgaagagtctctaggccgacctcaagaacttagtcaacaaggt
cgaatccttgaggcagctattaaagcagcagcaactgtggtcatcagtttaaaagatagt
ttgaacgaatgggatggaaaagtaggagacggggactgtggatcaacaatgtgcagaggg
gcaacagctattctggaggacatgaagaattattaccctctcaatgatgctgctgaaaca
gtgaatgagattggttcatctatcagaagagtcatggggggaacgagtggaataatttat
agtctcctctgcaaggcagcttatgctgagttaaaagctaatgctcagtcagaagtcact
cccaaaaactggtctgatgcactcaagtcatcaatctctgctgtcagtaaatatggtgga
gcaagtgcgggctatagaacgatgttagatgctctcatcccagcttcaaaagtcctcgag
gagaagctgagtgttggagaggaccctgtttctgcttttgttctgtctgctgaagctgca
actgcaggagcggaatcaaccattcagatgcaagcacaggccgggagatcgagctatgtg
tcagctgagattcttgcatcaattcctgatccgggcgcaatggctgcagcggcatggtac
agcgctgctgcaagagcagtgaaggagcagagccagggtttgtga

KEGG   Brassica napus (rape): 106423708Help
Entry
106423708         CDS       T04128                                 

Definition
(RefSeq) putative 3,4-dihydroxy-2-butanone kinase isoform X1
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00561  Glycerolipid metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106423708
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106423708
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     106423708
    2.7.1.29  glycerone kinase
     106423708
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     106423708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2 DUF3994
Motif
Other DBs
NCBI-GeneID: 106423708
NCBI-ProteinID: XP_013719931
AA seq 599 aa AA seqDB search
MATPAKKFINNPNDVVTEFIEGLVETYPGLQYLDGLPEVKVVLRADVSAADYDKVAVISG
GGSGHEPAQAGYVGEGMLTAAICGDVFASPPVDSILAGIRAVTGPMGCLLVVTNYTGDRL
NFGLAAELAKTEGFKVETVIVGDDCALPPPRGIAGRRGLAGTILVHKVAGAAAAAGLSLE
EVAAEAKHASEMVGTMGVALTVCSLPGQATSDRLGPEKMELGLGVHGEPGAAVVDIQPVD
VVVSHVLQQILSPETNYVPITRGNSVVLMVNGLGGAPLMELMIAAGKAVPKLQLEFGLAV
DRVYTGSFMSSLDMAGFSISIMKADQSILERLDAPTKAPSWPVGTDGNLPPSKIPVPLPP
FQQNKNEESLGRPQELSQQGRILEAAIEAAATVVISLKDSLNEWDGKVGDGDCGSTMCRG
ATAILEDVRNYYPLNDAAETVNEIGSSIRRVMGGTSGIIYSLLCKAAYAELKANVQSEVT
SKNWSDALKSSISAVSKYGGARAGYRTMLDALIPASRVLEEKLSIGEDPVSAFVLSGEAA
TAGAESTIQMQAQAGRSSYVSAQILASIPDPGAMAAAAWYSAAARAVKEQSQGLGIVIR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggctactccagctaagaaattcatcaacaaccccaacgatgtagtaacagagttcata
gagggtctggtcgaaacttatcctggacttcagtacttggatggcctccctgaggtcaag
gttgtactccgagctgatgtctcggctgcagattatgacaaggttgctgttatatcagga
gggggaagtgggcatgaaccagcacaagctgggtacgtgggagaaggaatgctaaccgcg
gctatttgcggtgatgtctttgcttctccaccggttgattccatcctagctgggattcga
gctgtaactggtccaatgggatgcctcttggttgtcacgaactatactggtgaccgcttg
aactttggcctagcagctgagctagctaaaactgagggtttcaaagtagagactgtgatt
gttggagatgactgtgctctcccaccgccacgtggcatagctggacgcagaggtttagca
ggaacaattcttgtccataaggtagctggagcagcagcagcagccggtctttccttagaa
gaagttgcggcagaagcaaagcatgcttctgagatggttgggaccatgggagttgcactg
actgtttgttcgcttccgggacaggccacatcagatcgtttgggtcctgagaaaatggaa
cttgggcttggtgttcatggggaacctggtgctgctgtggtcgacattcaacctgtggat
gttgtagtctcccatgttcttcaacagatactgagtccagagactaattatgttccgatt
acacgtggtaacagtgtggttctgatggttaatggcttaggtggtgcccctctaatggaa
cttatgattgcggctggaaaagcagtccctaaactacagttagaatttggacttgccgtt
gatagagtgtatactggatcttttatgtcatctcttgatatggcaggtttctcgatatcg
atcatgaaggctgaccagtcaattttagagcgtctggatgctccgaccaaggcacctagt
tggcctgttggcacggatgggaacctcccaccatcaaagatcccagttccactacctcca
ttccaacaaaacaaaaacgaagagtctctaggccgacctcaagaacttagtcaacaaggt
cgaattcttgaggcagcgattgaagcagcagcaactgtggtcatcagtttgaaagatagt
ttgaacgaatgggatggaaaagtaggagacggggactgtggatcaacaatgtgcagaggc
gcaacagctattttggaggacgtgaggaattattatcctctcaacgatgctgctgaaaca
gtgaatgagattggttcatctatcagaagagtcatgggaggaacgagtggaataatttac
agtctcctctgcaaggcagcttacgctgagttaaaagccaacgttcagtcagaagtcact
tccaaaaactggtctgatgcactcaagtcatcaatctctgctgttagtaaatatggtgga
gcaagggcaggttatagaacgatgttagatgctctcatcccagcttcgagagtccttgag
gagaagctgagtattggagaggaccctgtttctgcttttgttctgtctggtgaagctgca
accgcaggtgctgaatcaaccattcagatgcaagcacaggccgggagatcgagctatgtg
tcagctcagattcttgcatcaattcctgatccgggggcaatggctgcagcggcatggtac
agcgctgctgcaagagccgtgaaggagcagagccaggggttgggaattgtgatccgatag

KEGG   Brassica napus (rape): 106425096Help
Entry
106425096         CDS       T04128                                 

Definition
(RefSeq) putative 3,4-dihydroxy-2-butanone kinase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00561  Glycerolipid metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106425096
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106425096
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     106425096
    2.7.1.29  glycerone kinase
     106425096
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     106425096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 106425096
NCBI-ProteinID: XP_022558294
AA seq 642 aa AA seqDB search
MVYAADKFINNPNDAATDVIKGLVDTYPGLQYLFGFAIPKVTVVIQAGVSDKVAVISGGG
SGHEPAHAGYVGEGMLTAAICGDVFASPSVDSIVAGIRAVTGSQGCLLIVKNYTADRLNF
GLAAEQAKYEGYKVETVIVGEDCALPPPRGFAGRRGLAGTILVYKVAGAAAAAGLSLEEV
AAEAKCASEMVGTMGVAFSLCKLLGPVTSDRLGQKKMELGLGIHGEPGAAVVDVQPVDVV
VSLLLQKILSPETNYVPITRGDRVVLMANGLGFDGTYDCSWKNCMLQPRLQVGLLALMVR
EMLLHVLCLDSVKKSEHFVSLIVSSYPLYDAAETMYAIGASISKAIRGTIGIIYNLLCKA
AYAELKKANIDEEVTPRDWSEALKASIASVRKYGGATEGYRTMLDALIPASQVLEENLSA
GVDPVTAFSVSAAAATKGAKSTIQMQAQAGRSSYVSAENLATVPDPGAMAAAVWYRAAAR
AVRKKQHLKPYEGSVVPKSPTVPSRDRVFYFDFPDIGRHTCRDPTFVKILGAVEVTPSGG
SPRSTVGQSESLSCNLGASVSVREWGIIRFKKNGENKTFVARQGCRITVPFGGIVTYCNS
IEEISHHSGFWWNPYLLSYYSIPPQGIVEFLRTPDKTKGGYQ
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgcggccgataaattcatcaacaaccccaacgatgctgcgactgatgtcatc
aagggacttgtggacacttatcctggactccagtatttgtttggcttcgccattcctaag
gttacggtggtgatacaagctggtgtctctgacaaggttgccgtaatatcaggtggaggc
agtgggcatgagccagctcatgctggttacgttggagaaggaatgcttacagctgctatc
tgcggagatgtctttgcctctccatcagttgattccatcgtggctggaattcgtgctgta
actggttctcagggatgtcttttgatcgtcaagaactacactgctgaccgcttgaacttt
ggtttggctgctgagcaagcgaagtatgaaggttacaaagtagagactgttattgttgga
gaggattgtgctttaccccctcctcgaggttttgctggacgcaggggcttagcaggaact
attcttgtatataaggttgctggcgcagcagcagctgctggtctttctctagaagaagtt
gcggccgaggcaaaatgtgcgtctgagatggttggtaccatgggtgttgcattctctctt
tgtaagcttcttgggccggttacatcagaccgtctgggccaaaagaagatggaactcggg
cttggaattcatggagaacctggtgctgctgtggttgacgttcaacctgtggatgtggtg
gtttcacttcttcttcagaagatactgagtcctgagaccaattatgttccaattacacgc
ggtgacagagtggttctcatggctaatggcttaggatttgatggaacttatgattgtagc
tggaaaaactgtatgctccaaccaaggctccaagttggcctgttggcactgatggtccgt
gaaatgttgttacatgttctatgtttagattccgtaaaaaaatctgagcattttgtgtct
cttattgtatcaagttatccactctatgatgctgctgaaacgatgtatgccattggtgca
tccatcagcaaagccataaggggcacaattggaattatatacaatttactctgcaaggca
gcttacgcggagctaaaaaaggctaacattgacgaggaagtcactcccagagactggtct
gaagcactcaaggcatcaatagcttctgtgaggaaatatggtggagcaactgaggggtac
agaacgatgctagatgcgctcatcccagcttcacaagttcttgaagagaatctgagcgct
ggagtggacccagtaactgcttttagtgtgtcagctgctgcagcaactaaaggagcgaaa
tcaaccatacagatgcaagctcaggctgggagatcgagctatgtgtctgcagagaatctt
gcaacagttccagatccaggtgcaatggctgcagcagtatggtacagggcggcggcaaga
gccgtgaggaagaaacagcatctaaaaccttacgaaggtagcgttgttcccaaaagcccc
actgtcccttctcgagatcgtgtgttctacttcgacttccccgacattggtaggcacaca
tgtcgggaccctacctttgtcaaaattcttggtgccgtcgaggtgactccctccggtggc
tctcctcgctcaacggttgggcagtccgagagcctctcttgcaaccttggggcctcggtt
tcggttcgtgaatggggcataattcgcttcaagaagaacggtgagaataaaacgttcgta
gctcggcaaggatgtcggatcactgtaccatttggaggcattgtcacatattgcaacagc
attgaggagatttctcatcacagtggcttctggtggaacccttacctcttgtcgtactac
tctatccctccccaaggcattgttgagtttcttcgcactcctgacaaaacaaaaggaggt
taccagtag

KEGG   Brassica napus (rape): 106435969Help
Entry
106435969         CDS       T04128                                 

Definition
(RefSeq) putative 3,4-dihydroxy-2-butanone kinase isoform X1
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00561  Glycerolipid metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106435969
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106435969
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     106435969
    2.7.1.29  glycerone kinase
     106435969
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     106435969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 106435969
NCBI-ProteinID: XP_013732364
AA seq 595 aa AA seqDB search
MVYAAKKFINNPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAEKYDKVAVISG
GGSGHEPAHAGYVGEGMLTAAICGDVFASPPVDSILAGIRAVTGPQGCLLIVKNYTGDRL
NFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLAGTVLVHKVAGAAAAAGLSLE
KVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGQEKMELGLGIHGEPGAAVVDVQPVD
VVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAV
DRVYTGLFMTSLDMAGFSISIMKADQPILDRLDAPTKAPNWPFGTDGNRPPAKIPVPIPS
SRSAKSAESQARPKELSKQGRVLEAAIQAAATVISSLKDSLNEWDGKVGDGDCGSTMHRG
ATAILEDMKHYYPLNDAAETVNEIGASISRAMGGTSGIIYNLLCKAAYAELKANTESEVT
PKYWSKALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPICAFILSAEAA
TKGAESTIQMQAQAGRSSYVSAEMLATVPDPGAMAAAGWYSAAARAVKEQYQGSS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgcggcgaagaaattcatcaacaaccccaacgatgttgtgactgagttcatc
gagggacttgtggaaacttatcctggactccagtatttggatggctttcctgaggttaag
gtggtgctacgagctgatgtctctgctgagaagtatgacaaggttgccgttatatcaggt
ggaggcagtgggcatgagccagctcatgctggttacgttggagaaggaatgcttacagct
gctatctgcggagatgtctttgcttctccacctgttgattccatcctggctgggattcgg
gctgtcactggtcctcagggatgtcttttaatcgtcaagaactatactggcgaccgcttg
aactttggtttggctgctgagcaagcgaaatctgaaggttacaaagtagagactgtaatt
gttggagaggattgcgctttacccccacctcgtggtattgctggacgcagagggttagca
ggaaccgttcttgtacataaggtggctggcgcagcagcagcagctggtctttctctagaa
aaagttgcggccgaggcaaagtgtgcgtcggagatggttggtaccatgggtgttgcatta
tctgtttgtacgcttcctgggcaggttacatctgatcgcctgggccaagagaagatggaa
ctcgggcttggaattcatggagaacctggtgctgctgtggttgacgttcaacctgtggac
gtggtggtttcacatgttcttcagcagatactgagtcctgagaccaattatgttcccatt
acccgcggtaacagagtggttctcatggttaatggcttaggaggcacccctttgatggaa
cttatgatagctgctggaaaagctgtccctaaactgcagctggaatttggacttgctgtt
gatagggtgtatacagggctttttatgacttcgctcgatatggcaggattctcgatttca
atcatgaaagctgaccagccaatcttagaccgattagatgctccaactaaggctccaaat
tggccttttggcactgatggcaaccggccacccgcaaagatccctgttcctataccctct
tctcgatcagcaaaaagcgctgagtcccaggctcgacctaaagagctgagtaaacaaggt
cgggttcttgaggcagctattcaagcagcagctactgtgatcagtagtctaaaggatagt
ttgaacgaatgggatggaaaagtaggcgatggtgattgtgggtcaacaatgcacagaggt
gcaacagctattttggaagacatgaaacactattatccgctcaatgatgctgcggaaaca
gtgaatgagattggtgcatcaatcagcagggccatggggggcacaagtggaattatatac
aatctcctctgcaaggcagcgtacgcggagctaaaagccaacactgagtcagaagtcact
cccaaatactggtccaaagcactcaagtcatcaatagcttctgtcagcaaatatggtgga
gcaactgcgggatacaggacgatgctagatgcgcttatcccagcttcacaagttcttgaa
gagaagctaagcgctggagaggacccaatatgtgcctttattctgtcagctgaagcagca
actaaaggagcggaatcaaccatacagatgcaagcacaggctgggagatcgagctatgtg
tctgcagagatgcttgcaacagttccagatccaggtgcaatggctgcagcaggatggtac
agtgcggcagcaagagccgtgaaggagcagtatcaggggtcatcatga

KEGG   Brassica napus (rape): 106452017Help
Entry
106452017         CDS       T04128                                 

Definition
(RefSeq) putative 3,4-dihydroxy-2-butanone kinase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00561  Glycerolipid metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106452017
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106452017
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     106452017
    2.7.1.29  glycerone kinase
     106452017
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     106452017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 106452017
NCBI-ProteinID: XP_013749478
AA seq 595 aa AA seqDB search
MVYAAKKFINDPSDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAEKYDKVAVISG
GGSGHEPAHAGYVGEGMLTAAICGDVFASPPVDSILAGIRAVTGPQGCLLIVKNYTGDRL
NFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLAGTVLVHKVAGAAAAAGLSLE
KVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGQEKMELGLGIHGEPGAAVVDVQPVD
VVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAV
DRVYTGLFMTSLDMAGFSISIMKADQSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPIPP
SRSAKSAESQARPKELSQQGRVLEAAIQAAATVIISLKDSLNEWDGKVGDGDCGSTMHRG
ATAILEDMKHYYPLNDAAETVNEIGASISRAMGGTSGIIYNLLCKAAYAELKANTESKVT
PKYWSKALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPICAFILSAEAA
TKGAESTIQMQAQAGRSSYVSAEMLATVPDPGAMAAAGWYSAAARAVKEQYQGSS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgcggcgaagaaattcatcaacgaccccagcgatgttgtgactgagttcatc
gagggacttgtggaaacttatcctggactgcagtatttggatggctttcccgaggttaag
gttgtactacgagctgatgtctctgctgagaagtatgataaggttgctgttatatcaggt
ggaggcagtgggcatgagccagctcatgctggttacgttggagaaggaatgcttacagct
gctatctgcggagatgtctttgcttctccacctgttgattccatcttggctgggattcgg
gctgtcactggtcctcagggatgtcttttgatcgtcaagaactatactggtgaccgtttg
aactttggtttggctgctgagcaagcgaaatctgaaggttacaaagtagagactgtaatt
gttggagaggattgcgctttacccccacctcgtggtattgctggacgcagagggttagca
ggaaccgttcttgtacataaggtggctggcgcagcagcagcggctggtctttctctagaa
aaagttgcggccgaggcaaagtgtgcgtcggagatggttggtaccatgggtgttgcatta
tctgtttgtacgcttcctgggcaggttacatctgatcgtctgggccaagagaagatggaa
ctcgggcttggaattcatggagaacctggtgctgctgtggttgacgttcaacctgtggac
gtggtggtttcacatgttcttcagcagatactgagtcctgagaccaattatgttcccatt
acccgcggtaacagagtggttctcatggttaatggcttaggaggcacccctttgatggaa
cttatgatagctgctggaaaagctgtccctaaactgcagctggaatttggacttgctgtt
gatagggtgtacacagggctttttatgacttcgctcgatatggcaggattctcgatttca
atcatgaaggctgaccagtcaatcttagaccgattagatgctccaactaaggctccgaat
tggcctgttggcactgatggcaaccggccacctgcaaagatccctgttcctataccccct
tctcgatcagcaaaaagcgctgagtctcaggctcgacctaaagagctgagtcaacaaggt
cgagttcttgaggcagctattcaagcagcagcaactgtgatcatcagtctaaaggatagt
ttgaacgaatgggatggaaaagtaggcgatggtgattgtgggtcaacaatgcacagaggt
gcaacagctattttggaagacatgaaacactattatccgctcaatgatgctgcggaaaca
gtgaatgagattggtgcatcaattagcagggccatggggggcacaagtggaattatatac
aatctcctctgcaaggcagcgtacgcggagctcaaagctaacactgagtcaaaagtcact
cccaaatactggtccaaagcactcaagtcatcaatagcttctgtcagcaaatatggtgga
gcaactgcgggatacaggacgatgctagatgcgcttatcccagcttcacaagttcttgaa
gagaagctgagcgctggagaggatccaatatgtgcttttattctgtcagctgaagcagca
actaaaggagcggaatcaaccatacagatgcaagcacaggctgggagatcgagctatgtg
tctgcagagatgcttgcaacagttccagatccaggtgcaatggctgcagcaggatggtac
agtgcggcagcaagagccgtgaaggagcagtatcaggggtcatcatga

DBGET integrated database retrieval system