KEGG   Brassica napus (rape): 106360921Help
Entry
106360921         CDS       T04128                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
bna  Brassica napus (rape)
Pathway
bna00906  Carotenoid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    106360921
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     106360921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 106360921
NCBI-ProteinID: XP_013656051
AA seq 593 aa AA seqDB search
MYSVSSSSFISTFSPKPSLHLRHSSSSRLLPRINSTVVEERSPIINPSENNGPPHKKLYT
RTNRNAVASPAKLRPETTLVAALFTTVEDAINTFIDPPSRPSVDPKHVLSGNFAPVLDEL
PPTECEIIHGSLPPSLDGAYIRNGPNPQFLPRGPYHLFDGDGMLHAIRIRNGKATLCSRF
VKTYKYNVEKQNGAPVIPNVFSGFNGVTASVARGALTALRVLAGQYNPVNGIGLANTSLA
FFCNRLFALGESDLPYAVRLTDTGDIETIGRFDFDGKLEMSMTAHPKTDPETGETFAFRY
SPVPPFLTFFRFDSTGKKQRDVPVYSLTSPSFVHDFAITKRHAIFAEIQIVMRMNIMDLV
LEGGSPVGADNRKTPRLGVIPRNAGDDSEMKWFEVPGFNIIHAINAWDENDGTTVVLIAP
NIMSIEHTLERMDLVHSLVEKVKIDLVTGIVTRHPISARNLDFAVINPAFLGRRSRYVYA
AIGDPMPKISGVVKLDVSKGDRDDCTVARRMYGPGCYGGEPFFVARDPGDQEAEEDDGYV
VTYVHDEVAGESKFLVMDAKSPELEIVAAVRLPRRVPYGFHGLFVKESDVNKL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtactctgtttcttcctcttccttcatctctacattctctcctaaaccctctcttcat
cttcgccactcatcttcctctcgtcttcttccccgtatcaactccaccgtcgtcgaagaa
cgatccccgatcattaacccaagcgaaaacaatggccctcctcataagaaactctacact
cggactaaccgcaacgcagttgcatctccggcgaaactccgaccagaaacgactctcgta
gcagccctcttcaccaccgtagaagatgccatcaacacgttcatcgatccaccgtcacgt
ccttccgtagatccaaaacacgttctctcaggtaacttcgctcctgttctcgacgagctt
cctccaacggaatgtgagatcatccacggctctcttcctccgtctcttgacggcgcttac
atccgtaacggcccgaacccacagtttctccctcgtggcccttaccacctattcgacggt
gacggcatgcttcacgcgattcgtatccgtaatggtaaagccacgctctgtagcagattc
gtcaagacttataagtacaacgtcgagaaacaaaacggagctcccgtgatacctaacgtg
ttttcgggatttaacggcgtgacggcgtcagttgctcgtggagctttaacggcgttaagg
gttttagcgggacagtataatccggttaacggcattggtttggctaatacgagtctagcg
ttcttctgtaaccgtctcttcgctttaggagaatctgatttaccctacgccgtacgatta
acggacactggagatattgaaacgatcggacggttcgatttcgacgggaagttagagatg
agcatgacagctcacccgaaaaccgatcctgaaaccggagaaacgttcgctttccggtac
agtccggttccaccgtttttaacgtttttccggtttgattcaaccgggaagaaacaaaga
gacgttccggtttactccttgacgtctccatcgttcgttcacgacttcgcgatcacgaag
aggcacgcaatcttcgcggagattcagatcgtgatgaggatgaatataatggatctggtg
ctcgaggggggatctccggttggtgctgacaaccggaaaacgccgcggctcggagtgatt
cctcgtaacgccggcgatgattcggagatgaaatggtttgaagttcctggattcaacatc
attcacgctatcaatgcttgggatgaaaacgatggaaccaccgtcgttttgatcgctccg
aatattatgtccatcgagcatacgttagagaggatggatctcgttcactccttggtggag
aaggtgaagatcgatctcgtcacaggaatcgtgacacgtcatccgatctccgcgaggaac
ctcgatttcgcggtgatcaatccggcgtttctcgggaggcggagccggtacgtgtacgcg
gcgatcggggatccgatgccgaagatctccggagtggtgaagctcgacgtgagtaaaggc
gatcgggatgattgcacggtggcgcgtagaatgtacggtccaggttgttacggcggcgaa
ccgtttttcgtagcgagggatcctggtgatcaggaggcagaggaggatgacggttacgtg
gtgacatatgttcacgatgaggtggctggagagtcgaagtttttggtgatggacgcgaag
tcgccggagcttgaaatcgtcgcggccgtgaggttgccgcgaagggttccgtacggattc
cacggactatttgtaaaggagagcgacgttaataagctttaa

DBGET integrated database retrieval system