KEGG   Brassica napus (rape): 106361614Help
Entry
106361614         CDS       T04128                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
bna04141  Protein processing in endoplasmic reticulum
bna04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106361614
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106361614
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106361614
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106361614
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106361614
   03009 Ribosome biogenesis [BR:bna03009]
    106361614
   03110 Chaperones and folding catalysts [BR:bna03110]
    106361614
   04131 Membrane trafficking [BR:bna04131]
    106361614
   03051 Proteasome [BR:bna03051]
    106361614
   03029 Mitochondrial biogenesis [BR:bna03029]
    106361614
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106361614
Protein phosphatases and associated proteins [BR:bna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106361614
Spliceosome [BR:bna03041]
 Complex B
  Other components
   Prp19 complex
    106361614
 Complex C
   Prp19-CDC5 complex
    106361614
Ribosome biogenesis [BR:bna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106361614
Chaperones and folding catalysts [BR:bna03110]
 Heat shock proteins
  HSP70 / DNAK
   106361614
Membrane trafficking [BR:bna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106361614
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106361614
Proteasome [BR:bna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106361614
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106361614
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106361614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A PG_binding_4 CLTH
Motif
Other DBs
NCBI-GeneID: 106361614
NCBI-ProteinID: XP_013656843
AA seq 646 aa AA seqDB search
MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA
EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFY
SALTRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLI
ARNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDAIEQAIQWLENNQLGEADEFED
KMKELESICNPIIAKMYQGAGGEAAGMDDDAPPASGGAGPKIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaaaggagaaggtccagcgatcggtatcgacctcggtacgacgtactcttgc
gtcggagtgtggcaacacgaccgcgttgagatcatcgctaatgatcaaggtaacaggacc
acgccgtcttacgtcgctttcactgactccgagaggctcatcggtgatgccgctaagaac
caggtcgccatgaaccctatcaacaccgtcttcgatgctaagaggttgatcggtcgtcgt
ttcagcgacagctctgtacagagcgacatgaagctgtggccattcaagatcatcgcagga
cctgccgagaagccaatgatcgtagtcaactacaagggcgaggagaagcagttcgccgcc
gaggagatttcctccatggttctcattaagatgcgtgagattgctgaggcttacctcggc
gtcaccatcaagaacgccgtcgtcactgtccctgcctacttcaacgactctcagcgtcag
gctactaaggacgctggtgtgattgccggtttgaacgttatgcgtatcatcaacgagccc
accgctgctgctattgcctacggtcttgacaagaaggcgaccagcgttggagagaagaac
gtgttgatctttgatcttggtggtggtacttttgatgtctcccttctcactattgaggaa
ggtatctttgaggttaaggcgactgctggagacactcatcttggtggtgaggacttcgac
aacagaatggtgaaccacttcgttcaggagtttaagaggaagagcaagaaggacattacc
ggaaacccgagagctcttaggaggttgaggacggcctgtgagagagcgaagaggactctt
tcttccactgctcagaccaccatcgagattgactctctctttgagggtatcgacttctac
tctgcactcacccgtgctaggttcgaggagctcaacatggatctctttaggaagtgtatg
gagccagtggagaagtgtctccgtgatgctaagatggacaagagcaccgtccacgatgtt
gtacttgttggtggctccacccgtattcccaaggttcagcaattgcttcaggacttcttc
aacggcaaagagctttgcaagtctatcaaccccgacgaggccgttgcttacggtgctgcc
gttcagggagctattctcagcggtgaaggaaacgagaaggtccaggatcttctcttgctc
gatgtcacccctctctcactcggtcttgagaccgccggtggtgtcatgaccactttgatc
gcaagaaacacgaccataccaaccaagaaggagcaagtgttctcgacctactctgacaac
caaccaggtgtgttgatccaggtgttcgaaggggagagagccagaaccaaggacaacaac
ctcctcggtaagtttgagctctctggaatccctccggctccacgtggtgtcccccagatc
actgtctgcttcgacattgacgccaacggtatcctcaacgtctctgctgaggacaagacc
accggacagaagaacaagatcaccatcaccaacgacaagggtcgtttgtccaaggacgat
atcgagaagatggttcaagaggctgagaagtacaagtctgaggatgaggagcacaagaag
aaggtggaagccaagaacgctctcgagaactacgcttacaacatgaggaacaccatccag
gacgagaagattggtgagaagctaccggctgcagacaagaagaagatcgaggacgctatt
gagcaggcgattcagtggctggagaacaatcagttgggtgaggctgatgagttcgaggac
aagatgaaggagttggagagcatctgcaacccaatcattgccaagatgtaccaaggagct
ggtggtgaagccgcagggatggacgatgatgctcctcctgcctcaggcggtgctggccct
aagatcgaagaggtcgactaa

DBGET integrated database retrieval system