KEGG   Brassica napus (rape): 106363671Help
Entry
106363671         CDS       T04128                                 

Definition
(RefSeq) uroporphyrinogen-III synthase, chloroplastic-like
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bna  Brassica napus (rape)
Pathway
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106363671
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     106363671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4 UPF0180
Motif
Other DBs
NCBI-GeneID: 106363671
NCBI-ProteinID: XP_013658832
AA seq 249 aa AA seqDB search
MASLLSPFPLLSLQPPYHHHHSLKKGVPCLVRDSLSSSNSIPQVVVTRESGKNKQIIKAL
EKRGISSLELPLIQHARGPDFDRLPSLLTDKSFDWIIITSPQAASVFLEAWKAACSPKVK
VGVVGAGTARIFDEPVQASQGQLHLAFTPSKATGKVLASELPDNVGKSSSVLYPASLKAS
NEIEEGLSRRGFEVLRLNTYTTVPVQSVDATLLQQALSAPVLSVASPSAIRAWMNLIQNE
KQWSNKIMK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttctgtctcctttccctctcttatctcttcaaccaccttatcatcatcat
cattccctcaaaaagggggttccttgtctcgttcgagattcattgtcttcctccaattcg
attccccaggtggttgttacccgagaaagtggcaagaacaaacaaatcatcaaagccttg
gagaaacgagggatttcatctttagagctcccactgattcaacatgctcggggtcctgat
ttcgatcgccttccttctctactaactgataagagctttgactggatcatcataacctct
ccacaggcagcttctgtctttctcgaggcctggaaggcagcttgctctccgaaagtgaaa
gtaggtgtagtgggagctggaacagcccgtatatttgatgaaccagtgcaagcttcacaa
ggacagcttcatcttgcctttaccccatctaaagcaactggtaaagtcttggcttcagag
cttccagacaatgtgggcaaaagttcttctgtcttatacccggcttctctaaaagcaagc
aatgagattgaggaagggttgtccagacgtgggtttgaggttctgaggctgaatacatac
acaacagttcctgtgcaaagtgtagatgcgacgcttctgcaacaggcattgtctgcgcct
gttctttctgtagcttcaccttctgcaatccgggcctggatgaatttgattcaaaacgag
aagcaatggagtaataaaatcatgaaatag

KEGG   Brassica napus (rape): 106415229Help
Entry
106415229         CDS       T04128                                 

Definition
(RefSeq) uroporphyrinogen-III synthase, chloroplastic
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bna  Brassica napus (rape)
Pathway
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106415229
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     106415229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4 DUF3483 UPF0180
Motif
Other DBs
NCBI-GeneID: 106415229
NCBI-ProteinID: XP_013711328
AA seq 291 aa AA seqDB search
MASLLSPSPLLSLQPPHHSLKKGVPCLVRDSLSSSNSIPQVVVTRESGKNKQIIKALEKR
GISSLELPLIQHARGPDFDRLPSLLTDKSFDWIIITSPQAASVFLEAWKAACSPKVKVGV
VGAGTARIFDEPLQASQGALHLAFTPSKATGKVLASELPDNVGKTSSVLYPASLKASNEI
EEGLSRRGFDVLRLNTYTTVPVQSVDATLLQQALSAPVLSVGSPSAIRAWMNLIQNEKQW
SNNVACIGETTASAARRLGFKKVYHPEQPGLEGWVDSIMEALTAHEELHRF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttctgtctccttcccctctcttatctcttcaaccacctcatcattccctc
aaaaagggggttccttgtctcgttcgagattcattgtcttcctccaattcgattccccag
gtggttgttacccgagagagtgggaagaacaaacaaatcatcaaagccttggagaaacgt
gggatttcatctttagagctcccactgattcaacatgctcgcggacctgatttcgatcgc
cttccttctctactaactgataagagctttgactggatcatcataacctctccacaggca
gcttctgtctttctcgaggcgtggaaggcagcttgctctccaaaagtgaaagtaggtgta
gtcggagctggaactgcccgtatctttgatgagccactgcaagcttcacaaggagcgctt
catcttgcctttacaccatctaaagcaactggtaaagtcttggcttcagagcttccagac
aatgtgggcaaaacttcttctgtcttatacccggcttctctaaaagcaagcaatgagatt
gaggaaggattgtccaggcgtgggtttgacgttctgaggctgaatacatacacaacagtt
cctgtgcaaagtgtagatgcgacgcttctgcaacaggcattgtctgcgcctgttctttct
gtaggttcaccttctgcaatccgggcctggatgaatttgattcaaaacgagaagcagtgg
agtaataatgttgcctgcataggagagacaactgcttcagctgcaagacgactaggattt
aaaaaggtttaccacccggagcaaccagggcttgaaggatgggtcgacagcatcatggaa
gctctaaccgctcacgaagaattacacagattttaa

DBGET integrated database retrieval system