KEGG   Brassica napus (rape): 106365249Help
Entry
106365249         CDS       T04128                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bna  Brassica napus (rape)
Pathway
bna00350  Tyrosine metabolism
bna00360  Phenylalanine metabolism
bna00380  Tryptophan metabolism
bna00901  Indole alkaloid biosynthesis
bna00950  Isoquinoline alkaloid biosynthesis
bna00965  Betalain biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106365249
   00360 Phenylalanine metabolism
    106365249
   00380 Tryptophan metabolism
    106365249
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106365249
   00950 Isoquinoline alkaloid biosynthesis
    106365249
   00965 Betalain biosynthesis
    106365249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106365249
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106365249
    4.1.1.105  L-tryptophan decarboxylase
     106365249
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106365249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 106365249
NCBI-ProteinID: XP_013660149
AA seq 479 aa AA seqDB search
MDSEQLREYGHRMVDFIADYYKTIETFPVRSQVQPGYLHNLLPDSAPDHPETLEQVLDDV
KVKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSTGLNVIGFSWVASPAATELEIIVLD
WLAKLLNLPEQFLSKGKGGGVIQGSASEAILVVMIAARDKVLRTAGKNALGKLVVYSSDQ
THSALQKACQIAGIHPENWRVLKADTSTNYALRPELLQEAVSRDLEAGLIPFFLCGNVGT
TSSTAVDPLAALGKIAKSNEMWFHVDAAYAGNACICPEYRQYIDGVETADSFNMNAYKGL
LTNFDCSLLWVKDQYAVTEAFSANPEYLKNKASEANLVVDYKDWQIALSRRFRSLKLWMV
LRLYGAETLKSYIRNHIKLAKVFEQLVSQDPNFEVITPRIFSLVCFRIVPIDNDEKKCNS
RNLELLEAVNSSGKLFISHTALSGKMVLRFSIGAPLTEQKHVKEAWKVIQEEASYLLGK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggactctgagcaactgagagagtacggacatcgaatggttgatttcattgctgattat
tacaaaaccatcgaaactttccctgtccgtagccaagttcagcctggttatcttcataac
cttttgcctgattcagcaccagaccaccctgaaacgctggaacaagttcttgatgatgtt
aaggtgaagatattgcctggagtaacgcattggcaaagccctagtttctttgcttattac
ccttctaacagcagcgttgcagggttcttgggagagatgttgagtactggtcttaatgtt
attggttttagttgggtagcttctccagctgccactgagctcgaaataatcgttcttgat
tggcttgcaaaactgctcaacctacccgaacagtttctctccaaaggaaaaggaggtgga
gtcatccaagggtcagctagtgaagctattcttgttgttatgattgctgctcgagataag
gtcttaagaactgctggcaagaacgcgcttgggaagcttgttgtctactcctctgaccag
acacattcagctttacaaaaagcttgccaaatagccggaatccatccggagaattggagg
gttctgaaggcagatacctctacaaactatgctctgcgtccagaattgcttcaagaagcc
gtttctcgggatcttgaagctggattgattcctttcttcttgtgtggcaatgttggaacc
acttcttcaaccgcagttgatccgttagccgcactgggaaagattgcaaagagcaatgag
atgtggtttcatgtggatgcagcgtacgctgggaatgcatgcatatgtccagagtataga
cagtacatagacggagtagaaactgcagactcatttaacatgaatgcttacaaagggctc
ctcacaaacttcgactgttccctactctgggtgaaggatcagtatgctgtcactgaagcc
ttttcagcaaatccagagtatctcaaaaacaaggcctctgaggcaaacttggttgttgat
tacaaagattggcaaatcgctctctcacgaagattcagatcattgaaactatggatggtt
ttaaggctctatggagctgagacattgaagagctatataagaaaccatatcaaactggct
aaagtttttgaacaacttgtctctcaagatcctaactttgaggttatcactcctcggatc
ttttctctcgtctgctttcgtatcgttcctatcgataacgacgaaaagaagtgtaatagt
cgaaacctcgagctcctagaggcagtgaattcctcagggaaactcttcatttctcacact
gctttgtcgggaaaaatggttctacgtttttccataggagcgccattgacagagcagaag
cacgtgaaggaggcatggaaggtcatccaggaggaagcttcgtacttgcttggcaagtaa

DBGET integrated database retrieval system