KEGG   Brassica napus (rape): 106366405Help
Entry
106366405         CDS       T04128                                 

Definition
(RefSeq) mannose-6-phosphate isomerase 1 isoform X2
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106366405
   00520 Amino sugar and nucleotide sugar metabolism
    106366405
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     106366405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI Cupin_2 P2 AraC_binding Cupin_6
Motif
Other DBs
NCBI-GeneID: 106366405
NCBI-ProteinID: XP_013661461
UniProt: A0A078J274
AA seq 433 aa AA seqDB search
MEIATVVKANGGCEADRRRRLRRLRCSVKDYAWGKIGSDSLVYRVYAANSDQPIDSTRPY
AELWMGTHESGPSYLEDDDADGGVTLRSWIAENPEALGDRVLEKWGCDLPFLFKVLSVGR
ALSIQSHPDKVLAKKLHKAHPNLYKDDNHKPEMALAYTQFEALCGFIPLQELKSVIRAIP
EIEELVGSEEANQVFCISEHDEEKVKSAVRTIFTLLMSAGPDTTKQIVSKLKHRLHMESQ
ERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPHAYLFGECIEVM
ATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLPPFEEFEVDLCD
LPCGASTVFPSVPGPSLLLVLQGEGRMSTDASADEISMGDVLFVPADTEIHLESSSDLKL
YRAGINSRFLDSP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgctactgtcgtcaaggcaaatggcggttgcgaagcggatcgacgacggcgg
ctccgccggttgagatgctccgtgaaggattacgcttggggcaaaatcgggtcggattca
ctcgtgtacagagtctacgcggcgaattcggatcaaccaatcgattcgacgagaccgtac
gcggagctttggatggggactcacgagtcaggtccgagttacttggaggatgatgatgct
gatggtggcgtgacgcttagatcgtggattgctgaaaaccctgaggctcttggagatagg
gttttggagaaatggggttgtgatcttccctttctcttcaaggtgttgtcggtgggaagg
gccttgtcgattcagtcacatccggataaggttttggcgaagaaattgcataaagctcat
cctaatctatataaagatgataatcacaagcctgagatggcattggcttatactcagttc
gaggctctttgtgggtttatacctctacaggagcttaagagtgtgattcgtgctattcct
gagatagaagagcttgttgggagtgaagaagcaaaccaagtcttctgcatcagtgaacat
gatgaggagaaagtcaaatctgctgtccgaactatcttcaccctgctaatgtctgcaggt
cccgacacaacaaagcaaatcgtatccaaactgaaacaccgtctgcatatggagagtcag
gaacgccatctgacagacaaggaacggctagttttgaagctagagaagcagtatccagat
gacattggggtcatctctgcattcttcttcaactacgtaaagctcaatcctggtgaagcc
ttgtaccttggtgcaaacgagccacatgcatacttattcggtgagtgcattgaggtcatg
gccacttcagacaacgtagtacgagctggcctcacttccaagcctctggatattcaaaca
ctttgttccatgctctcatacaaactgggctttcctgagatcctaaagggatcaaggatt
cgaccatacatcacaagatacctcccgcctttcgaggagtttgaggttgatctctgtgat
cttccctgtggagcctcgacggtgtttccctctgttccaggcccttctcttctgcttgtg
ctccaaggggaaggaagaatgtctacagacgcttcagcagatgagatttcgatgggagat
gttctgtttgtgcctgcagacactgagattcacttagagtcttcatctgacttgaagctg
tacagagcaggaattaacagtaggtttttggattctccatag

KEGG   Brassica napus (rape): 106366807Help
Entry
106366807         CDS       T04128                                 

Definition
(RefSeq) mannose-6-phosphate isomerase 1-like
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106366807
   00520 Amino sugar and nucleotide sugar metabolism
    106366807
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     106366807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI Cupin_2 Cupin_6 P2
Motif
Other DBs
NCBI-GeneID: 106366807
NCBI-ProteinID: XP_013661922
AA seq 431 aa AA seqDB search
MEIATAAKANGGCRRRLLRLKCSVKDYAWGTIGSDSLVYKVYTANSDDRIDSTTRPYAEL
WMGTHESGPSYLEEDADGSSGVTLRSWINENPESLGDRVLEKWGCDLPFLFKVLSVARPL
SIQAHPDKVLAKKMHKAHPNLYKDDNHKPEMALAYTQFEALCGFIPLQELKSVIRAIPEI
EELVGSEEANQVFCISEHDEEKVKSAVRTIFTLLMSAGPDTTKQIVFKLKRRLHMESQER
HLTEKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPHAYLFGECIEVMAT
SDNVVRAGLTSKPLDIQSLCSMLTYKLGFPEILKGTRIRPYITRYLPPFEEFEVDVCDLP
PGASTVFPSVPGPSLLLVLQGEGRMSTDASADEVSMGDVLFVPADTEIQLKSSSDLKLYR
AGVNNRFLYSQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgctaccgccgcgaaggcaaacggcggttgtcgacggcgtcttctccgattg
aaatgctccgttaaggattacgcttggggcacgatcgggtcggattcgctcgtttataag
gtttacacggcgaattccgatgaccggatcgattcgacgacgcggccgtacgcggagctt
tggatggggactcacgagtcgggtccgagttacttggaggaggatgctgatggctccagt
ggcgtgactctcagatcgtggattaatgaaaaccctgagtctctcggagacagggttttg
gagaaatggggctgcgatctcccctttctcttcaaggtgttgtcggtggcgaggcccttg
tcgattcaagcacatccggacaaggttttggcaaagaaaatgcataaagcgcatcccaat
ttatacaaagatgacaatcataaaccagagatggcattggcttatactcaattcgaggca
ctttgtgggtttatacctcttcaggagctgaagagtgtgattcgtgctattccggagatt
gaagaacttgttgggagtgaagaagcaaaccaagtcttctgcatcagtgaacatgatgag
gagaaagttaaatctgctgtccgaaccatcttcaccctactgatgtctgcaggacctgac
acaacaaagcagattgtgttcaaactaaaacgccgtctgcatatggagagtcaggaacgc
catctgacagagaaggaacggctagtgttgaagctagagaagcaatatccaaatgacatt
ggggtcatatctgccttcttcttcaactatgtgaagctcaatcctggtgaagccttgtac
ctcggtgcaaacgagccacatgcatacttattcggtgagtgcattgaggtcatggcgact
tcagacaatgtagtaagagctggcctcacttccaagcctctggatattcaatcactttgt
tccatgctcacatataaactgggctttcctgaaatcctaaagggaacaaggattagacca
tacatcacgagatacctcccgcctttcgaggagttcgaagttgatgtctgtgatctcccc
cctggagcctccacggtgtttccctctgtaccaggcccttctcttctgcttgtactccaa
ggtgaaggaagaatgtctacagacgcttcagcagatgaggtttcaatgggagatgttctc
tttgtgcctgcagatactgagattcaattgaagtcttcttccgacttgaagctgtacaga
gcaggagtgaacaataggtttttgtattctcaatag

KEGG   Brassica napus (rape): 106381063Help
Entry
106381063         CDS       T04128                                 

Definition
(RefSeq) mannose-6-phosphate isomerase 2-like
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106381063
   00520 Amino sugar and nucleotide sugar metabolism
    106381063
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     106381063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI Cupin_2 AraC_binding
Motif
Other DBs
NCBI-GeneID: 106381063
NCBI-ProteinID: XP_013676377
AA seq 444 aa AA seqDB search
MGADAIQTNGGDPAKLTVVEGIKRLRCAVKNYEWGKLGHDSLVARLHEANSGNRVDPAVP
HAELWMGTHESGPSHVVKEEELGSGHCGSDCMVTLKSWVSDNPDVLGSRAVDKWGCDLPF
LFKLLSVTKALSIQAHPNRALAEKLHREEPLLYRDANHKPEIALAITPFQALCGFVSLKE
LKEVIANVPEITELVGSKAADQIFTVNEKDGDESIKSVVRLIFTQLMSASNNETKRVISE
MKMRLITETNHRELSEKEKLILELEKQYPGDVGVISAFFFNYVKLNPGEALYLDADEPHA
YISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYITRYLPP
FDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVPAHNEI
QVTGESDVIKLYRAGVSSRFFQTL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagacgcaatccaaacgaacggtggtgatcccgccaagttaaccgtcgtagaa
gggatcaaacggttgagatgcgccgtgaagaactacgagtggggcaaactcgggcatgac
tcactggttgcgagactccacgaggccaattcagggaaccgtgtcgacccggcggttcct
cacgccgagttgtggatgggtactcacgagtcaggcccgagtcacgttgtaaaggaagag
gaactcgggtcgggtcattgtgggtccgactgcatggttacgttgaagtcgtgggtttcg
gataacccggatgtgctcgggtctagagccgtggacaaatggggatgtgatcttcctttc
ctcttcaagcttttgtcagtgacaaaagcgttgtcgattcaagcacatccaaacagggca
ttagcagagaaattgcatagagaagagcctcttctttacagagatgctaaccataagcct
gagatcgcgctggcaattactccttttcaagcactttgtggtttcgtatctcttaaggaa
ctaaaggaagtgattgccaatgtaccagagatcacagagctcgttggaagtaaagctgca
gatcaaatcttcaccgtcaacgaaaaagacggagacgagagtataaaatccgttgtccgt
ttgatcttcacacagttaatgtctgcaagtaacaatgagacgaaacgagtcatatctgag
atgaagatgcgtctaatcacggagacaaaccaccgtgagctatctgagaaggagaagtta
attttggaactagagaaacagtatccaggtgacgtaggcgtgatctcagctttctttttt
aactacgtcaagcttaatcccggagaggctttgtatttggatgcggacgagccacacgct
tacatctccggcgactgtgtcgagtgtatggcggcttcagacaacgttgttagagcaggt
ctcactcctaaacaccgcgatgtccagacgctatgctctatgcttacctataaactgggc
tacccggagattttgaaaggatttcctctgactccatacattacaagatatcttccccca
tttgatgaatttgaagtggaccattgtgatcttcctacagggaaatcgacgatttttccg
gccatacccgggccttcggtttatctggttatagaaggaacagggaaactgcaaaccggt
tcatctcaattgttggttaaccgaggagatgttttgtttgttccggctcataacgagatt
caggtaacaggagaaagtgatgtgataaagctttacagagctggagtcagcagcagattc
ttccagacactctag

KEGG   Brassica napus (rape): 106387286Help
Entry
106387286         CDS       T04128                                 

Definition
(RefSeq) mannose-6-phosphate isomerase 1-like
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106387286
   00520 Amino sugar and nucleotide sugar metabolism
    106387286
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     106387286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI Cupin_2 P2 Cupin_6
Motif
Other DBs
NCBI-GeneID: 106387286
NCBI-ProteinID: XP_013682569
AA seq 432 aa AA seqDB search
MEIATVVKANGGCRRRLLRLKCSVKDYAWGTIGSDSLVYKVYTANCDDRIDSTTKRPYAE
LWMGTHESGPSYLEEDADGSSGVTLRSWINENPESLGDRVLEKWGCDLPFLFKVLSVARP
LSIQAHPDKVLAKKMHKAHPNLYKDDNHKPEMALAYTQFEALCGFIPLQELKSVIRAIPE
IEELVGSEETNQVFCISEHDEEKVKSAVRTIFTLLMSAGPDTTKQIVFKLKRRLHMESQE
RHLTEKERLVLKLEKQYPNDIGVISAFFFNYIKLNPGEALYLGANEPHAYLFGECIEVMA
TSDNVVRAGLTSKPLDIQSLCSMLTYKLGFPEILKGTRIRPYITRYLPPFEEFEVDICDL
PSGASTVFPSVPGPSLLLVIHGEGRMSTDASADEVSVGDVLFVPADTEIQLKSSSDLKLY
RAGVNNRFLYSL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgctaccgtcgtgaaggcaaacggcggttgtcgacggcgtcttctccgattg
aaatgctccgtaaaggattacgcttggggcacgatcgggtcggattcgctcgtttataag
gtttacacggcgaattgcgatgaccggatcgattcgacgacgaagaggccgtacgcggag
ctttggatggggactcacgagtcgggtccgagttacttggaggaggatgctgatggctcc
agtggcgtgacgcttagatcgtggattaatgaaaaccctgagtctcttggagacagggtt
ttggagaaatggggctgcgatctcccctttctcttcaaggtgttgtcggtggcgaggcca
ttgtcgattcaagcacatccggataaggttttggcaaagaaaatgcataaagctcatccc
aatctatacaaagatgacaatcacaaaccagagatggcattggcttatactcagttcgag
gctctttgtgggtttatacctcttcaggagctgaagagtgtgattcgtgctattccggag
attgaagaacttgttgggagtgaagaaacaaaccaagtcttctgcatcagtgaacatgat
gaggagaaagttaaatctgctgtccgaaccatcttcaccctgctgatgtctgcaggacct
gacacaacaaagcagattgtgttcaaactaaaacgccgtctgcacatggagagtcaggaa
cgccatctgacagaaaaggagcggctggtgttgaagctagagaagcaatatccaaatgat
ataggggtcatatctgcgttcttcttcaactacataaagctcaatcctggtgaagccttg
tacctcggtgcaaacgagcctcatgcatacttattcggtgagtgcattgaggtcatggcg
acttcagacaatgtagtaagagctggtctcacttccaagcctctggatatccaatcactt
tgttccatgctcacatataaactgggctttcctgaaatcctaaagggaacaaggattaga
ccatacattactagatacctcccgcctttcgaggaattcgaagttgatatctgtgatctt
ccctctggagcctcgaccgtgtttccctctgtgccaggtccttctcttctgcttgtaatc
catggtgaaggaagaatgtctacagacgcttctgcagatgaggtttcagtgggagatgtt
ctgtttgtgcctgcagatactgagattcaattgaagtcttcatcagacttgaagctgtac
agagcaggagtgaacaataggtttttgtattctctatag

KEGG   Brassica napus (rape): 106391840Help
Entry
106391840         CDS       T04128                                 

Definition
(RefSeq) mannose-6-phosphate isomerase 2-like
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106391840
   00520 Amino sugar and nucleotide sugar metabolism
    106391840
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     106391840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI Cupin_2 AraC_binding
Motif
Other DBs
NCBI-GeneID: 106391840
NCBI-ProteinID: XP_013688020
AA seq 444 aa AA seqDB search
MGADAIQTNGGDPAKLTVVEGIKRLRCAVKNYEWGKLGHESLVARLHEANSGNRVDPAVP
HAELWMGTHESGPSHVVKEEELGSGHCGSDCMVTLKSWVSDNPDVLGSRAVDKWGCDLPF
LFKVLSVTKALSIQAHPNKALAEKLHREEPLLYRDANRKPEIALAITPFQALCGFVSLKE
LKEVIANVPEIPELVGSKAADQIFTVNEKDGEESVKSVVRLIFTQLMSATNNETKRVISE
MKMRLITETNHRELSEKEKLVLELEKQYPGDVGVISAFFFNYVKLNPGEALYLDADQPHA
YISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYITRYLPP
FDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVPAHNEI
QVTGESDVIKLYRAGVSSRFFQTL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagacgcaatccaaacgaacggtggtgatcccgccaagttaaccgtcgtagaa
gggatcaaacggttgagatgcgccgtgaagaactacgagtggggcaaactcgggcatgaa
tcactggttgcgagactccacgaggccaattcagggaaccgtgtcgacccggcggttcct
cacgccgagttgtggatgggtactcacgagtcaggcccgagtcacgttgtaaaggaagag
gaactcgggtcgggtcattgtgggtccgactgcatggttacgttgaagtcgtgggtttcg
gataacccggatgtgctcgggtctagagccgtggacaaatggggatgtgatcttcctttc
ctcttcaaggttttgtcagtgacaaaagcgttgtcgattcaagcacatccaaacaaggca
ttagcagagaaattgcatagagaagagcctcttctttacagagatgctaaccgtaagcct
gagattgctctggcaattactccttttcaagcactttgtggtttcgtatctcttaaggaa
ctaaaggaagtgatcgccaatgtaccagagatcccagagctcgttggaagtaaagctgca
gatcaaatcttcacggtcaacgaaaaagacggagaggagagtgtaaaatctgttgtccgt
ttgatcttcacacagttaatgtctgcaactaacaatgagacgaagcgagtcatatctgag
atgaagatgcgtctaatcacggagacaaaccaccgtgaactatctgagaaggagaagtta
gttttggaactagagaaacagtatccaggtgacgtaggcgtgatctcagctttctttttt
aactacgtcaagcttaatcccggagaggctttgtatttggatgcggaccagccacacgct
tacatctccggcgactgtgtcgagtgtatggcggcttcagacaacgttgttagagctggt
ctcactcctaaacaccgcgatgttcagacgctatgctctatgcttacctataaactgggc
tacccggagattttgaaaggatttcctctgactccatacattacaagatatcttccccca
tttgatgaatttgaagtggaccattgtgatcttcctacagggaaatcgacgatttttccg
gccatacccgggccttcggtttatctggttatagaaggaacagggaaactgcaaaccggt
tcatctcaattgttggttaaccgaggagatgttttgtttgttccggctcataacgagatt
caggtaacaggagaaagtgatgtgataaagctttacagagctggagtcagcagcagattc
ttccagacactctag

DBGET integrated database retrieval system