KEGG   Brassica napus (rape): 106367204Help
Entry
106367204         CDS       T04128                                 

Definition
(RefSeq) formate dehydrogenase, chloroplastic/mitochondrial-like
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106367204
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     106367204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH IlvN F420_oxidored UDPG_MGDP_dh_C DpaA_N
Motif
Other DBs
NCBI-GeneID: 106367204
NCBI-ProteinID: XP_013662379
AA seq 384 aa AA seqDB search
MMAMRRFTGAAIRACSSSSSSGYFARHLHASSGESKKIVGVFYKANEYASKNPNFLGCVE
NSLGIRNWLESQGHQYIVTDDKEGLDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNL
QLLLTAGIGSDHIDLQAAAAAGLTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVN
GEWNVAGIAYRAYDLEGKTIGTVGAGRIGKLLLQRLKPFGCNLLYHDRLQMEPELEKEIG
ANYVENLNEMLPKCDVVVLNMPLTEKTRGMFNKEMIAKMKKGVLIVNNARGAIMDRQAVV
EAMESGQIGGYSGDVWDPQPAPKDHPWRYMPNQAMTPHISGTTMDAQIRYAAGTKDMLEK
YFKGEDFPAQNYIVKDGVIAPQYM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatggctatgagacgtttcaccggggcggcgatcagggcctgttcttcctcttcgtct
tctggctactttgctcgccaccttcatgcttcttctggtgagagcaaaaagattgttgga
gttttctacaaagccaatgaatacgcttccaagaaccctaacttcctcggctgcgtcgag
aactccttaggaatccgcaactggctcgaatcacaaggacatcagtacattgtcactgac
gacaaagaaggtctagactgtgaacttgagaagcacatcccggatcttcatgtcttgata
tccaccccatttcacccggcttacgtgactgcggaaaggatcaagaaagccaagaacctc
cagcttctcctcactgctggtattggatccgaccacatcgacctacaagcagctgcagct
gctggcctgacggtggctgaagtcacaggaagcaacgtggtctctgtggcagaagatgag
ctgatgagaatcctgatcctcatgcgcaactttgtaccagggtacaaccaggtcgtcaat
ggagagtggaacgttgcggggattgcgtatagagcgtatgatctggaagggaagacgata
ggaaccgtaggagctggaagaatcgggaagcttttgttgcaaaggttaaaaccgttcggg
tgcaacttattgtaccatgacaggcttcagatggagcctgagctggagaaagagattggt
gctaactacgttgagaacttgaatgaaatgcttcctaagtgtgatgttgtggttctcaac
atgcctctcacggagaagacaagaggaatgttcaacaaagagatgatagcgaaaatgaag
aaaggagttttgatagtgaacaatgcaagaggagccatcatggacaggcaagctgtggtg
gaagcgatggagagtggacagatcggagggtatagcggagacgtttgggacccacagcca
gcacctaaggaccatccatggcgttacatgcctaaccaagccatgacccctcacatctct
ggcaccaccatggatgcacagatacgttatgcggcggggactaaagacatgttggagaag
tacttcaagggagaagacttccctgctcagaattacattgtcaaggatggtgtgattgct
cctcagtacatgtga

KEGG   Brassica napus (rape): 106372119Help
Entry
106372119         CDS       T04128                                 

Definition
(RefSeq) formate dehydrogenase, chloroplastic/mitochondrial
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106372119
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     106372119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH IlvN UDPG_MGDP_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 106372119
NCBI-ProteinID: XP_013667708
AA seq 384 aa AA seqDB search
MAMRRVTRAAIRASCVSSSSSGYFARKFNASSGDSKKIVGVFYKANEYASKNPNFLGCVE
NALGIRNWLESQGHHYIVTDDKEGPNCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNL
QLLLTAGIGSDHIDLQAAAAAGLTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVN
GEWNVAGIAYRAYDLEGKTVGTVGAGRIGKLLLQRLKPFGCNLLYHDRLQMGPEMEKETG
AKYVESLDEMLPKCDVVVVNTPLTEKTRGMFNKEMIGKMKKGVLIVNNARGAIMDRQAVV
EAVESGHIGGYSGDVWDPQPAPKDHPWRYMPNQAMTPHISGTTIDAQLRYAAGTKDMLEK
YFKGEDFPAQNYIVKDGELAPQYR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagaagagtcaccagagcagcgatcagggcctcctgcgtttcgtcttcatct
tctggttattttgccagaaaatttaatgcttcttctggagatagcaaaaagattgttgga
gttttctacaaggccaacgaatacgcttcaaagaatcctaacttccttggctgcgtcgag
aacgctttaggtatcaggaactggcttgaatcacaaggtcatcactacattgtcactgac
gacaaagaaggtccaaattgcgagctcgagaagcatatccctgaccttcacgtcctcata
tccaccccattccacccggcttacgtcactgcggaaagaatcaagaaggccaagaacctt
cagcttctcctcacagccgggatcggatccgaccacatcgatctgcaggcagctgcagct
gctggactgacggtcgctgaagtcacgggaagcaacgttgtctccgtggctgaggacgag
ctcatgaggatcttgatcctcatgcgcaacttcgttccggggtacaaccaagtcgtgaat
ggagagtggaacgtggcaggcattgcttatagagcgtatgatctggaaggcaagacggtg
ggaactgtgggagctggtagaatcgggaagcttttgctacagcggttgaagccgttcggg
tgcaacttgttgtaccatgacaggctccagatgggaccggagatggagaaggaaactggt
gctaagtatgttgagagtcttgatgagatgctccctaaatgcgacgttgtagtcgtcaac
acccctctcactgagaagacaagaggaatgtttaacaaggagatgatagggaaaatgaag
aaaggcgttttgattgtgaataacgcgagaggagccatcatggataggcaagcggtggtg
gaggcggtggagagcggacacatcggaggctacagcggagacgtgtgggacccgcagccg
gcgcctaaggaccatccatggcgttacatgccgaaccaagccatgactcctcacatctct
ggcaccaccattgatgctcagctacgatatgcggcggggacgaaagacatgttggagaag
tatttcaagggagaggacttccctgctcagaactacatcgttaaggatggtgagcttgct
cctcaatacaggtaa

KEGG   Brassica napus (rape): 106418386Help
Entry
106418386         CDS       T04128                                 

Definition
(RefSeq) formate dehydrogenase, chloroplastic/mitochondrial
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106418386
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     106418386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH IlvN UDPG_MGDP_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 106418386
NCBI-ProteinID: XP_013714536
UniProt: A0A078F5X4
AA seq 383 aa AA seqDB search
MAMRRITGAIRASCVSSSSSGYFARQFHASSGDSKKIVGVFYKANEYASKNPNFLGCVEN
ALGIRNWLESQGHHYIVTDDKEGPNCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQ
LLLTAGIGSDHIDLQAAAAAGLTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVNG
EWNVAGIAYRAYDLEGKTVGTVGAGRIGKLLLQRLKPFGCNLLYHDRLQMGPEMEKETGA
KYVESLDEMLPKCDVVVVNTPLTEKTRGMFNKEMIGKMKKGVLIVNNARGAIMDRQAVVE
AVESGHIGGYSGDVWDPQPAPKDHPWRYMPNQAMTPHISGTTIDAQLRYAAGTKDMLEKY
FKGEDFPAQNYIVKDGELAPQYR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcgaagaatcaccggagcgatcagagcctcctgcgtttcctcctcttcttct
ggttattttgccagacagtttcatgcttcttctggagatagcaaaaagattgttggagtt
ttctacaaggccaacgaatacgcttcaaagaatcctaacttccttggctgcgtcgagaac
gctttaggtatccgcaactggcttgaatcacaaggtcatcactacatcgtcactgacgac
aaagaaggtccaaattgcgagcttgagaagcatatcccagaccttcacgtcctaatatcc
acccccttccacccggcttacgtcaccgccgagagaatcaagaaggccaagaaccttcag
cttctcctcacggccggtattggatccgaccacatcgatctgcaggcggctgcggctgct
ggactgaccgtggctgaagtcacgggaagcaacgttgtctccgtggcagaagacgagctg
atgaggatcttgatcctcatgcgcaacttcgttccggggtacaaccaagtcgtgaatgga
gagtggaacgtggcaggcattgcttacagagcgtacgatctggaaggcaagacagttgga
actgtgggagctggtagaatcgggaagctactgctacagaggctgaagccgttcgggtgc
aacttgttgtaccatgacaggcttcagatgggaccggagatggagaaggaaactggtgct
aagtatgttgagagtcttgatgagatgcttcctaaatgcgatgttgtagtcgtcaacact
cctctcacggagaagacaagaggaatgtttaacaaggagatgatagggaaaatgaagaaa
ggcgttttgattgtgaacaacgcgagaggagccatcatggataggcaagcggtggtggag
gcggttgagagcggacacatcggagggtacagcggagacgtgtgggacccgcagccagcg
cctaaggaccatccatggcgttacatgccgaaccaagccatgactcctcacatctctggc
accaccattgatgcccagctacgatatgcggcggggacaaaagacatgttggagaagtat
ttcaagggagaggacttccctgctcagaactacatcgtcaaggatggtgagcttgctcct
caatacaggtaa

KEGG   Brassica napus (rape): 106429915Help
Entry
106429915         CDS       T04128                                 

Definition
(RefSeq) formate dehydrogenase, chloroplastic/mitochondrial
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106429915
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     106429915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH IlvN F420_oxidored UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-GeneID: 106429915
NCBI-ProteinID: XP_013726138
AA seq 384 aa AA seqDB search
MMAMRRFTGAAIRACSSPSSSGYFARHLHASSGESKKIVGVFYKANEYASKNPNFLGCVE
NSLGIRNWLESQGHQYIVTNDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNL
QLLLTAGIGSDHIDLQAAAAAELTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVN
GEWNVAGIAYRAYDLEGKTIGTVGAGRIGKLLLQRLKPFGCNLLYHDRLQMEPELEKEIG
ANYVENLNEMLPKCDVVVLNMPLTEKTRGMFNKEMIGKMKKGVLIVNNARGAIMDRQAVV
EAMESGQIGGYSGDVWDPQPAPKDHPWRYMPNQAMTPHISGTTMDAQIRYAAGTKDMLEK
YFKGEDFLAQNYIVKDGVIAPQYM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatggctatgcgacgtttcaccggagcagcgatcagagcctgttcttccccttcttcc
tctggctactttgctcgccatcttcatgcttcttctggtgagagcaaaaagattgttgga
gttttctacaaggccaacgaatacgcttccaagaaccctaacttcctcggctgcgtcgag
aactccttaggaatccgcaactggcttgaatcacaaggacatcagtacattgtcactaac
gacaaagaaggtccagactgcgaacttgagaagcacatcccggatctccatgtcttgata
tccaccccatttcacccggcttacgtgactgcggaaaggatcaagaaagccaagaacctg
cagcttctcctcactgctggtattggatccgaccacattgacctacaggcagctgcagct
gctgaactgacggtggctgaagtcactggaagcaacgtggtctcggtagcagaagatgag
ctgatgagaatcctgatcctcatgcgcaactttgtaccggggtacaaccaggtcgttaat
ggggaatggaacgttgcggggattgcgtatagagcgtatgatcttgaagggaagacgata
ggaaccgtaggagctggaagaatcgggaagcttttgcttcagcggttgaaaccattcggg
tgcaacttattgtaccatgacaggcttcagatggagcctgagctggagaaagagattggt
gctaactacgttgagaacttgaatgaaatgcttcctaagtgtgatgttgtggttcttaac
atgcctctcacggagaagacaagaggaatgttcaacaaagagatgatagggaaaatgaag
aagggagttttgatagtgaacaatgcaagaggagccatcatggacaggcaagctgtggtg
gaagcgatggagagtggacagatcggagggtatagcggagacgtttgggacccacagcca
gcacctaaggaccatccatggcgttacatgcctaaccaagccatgacccctcacatctct
ggcaccaccatggatgcacagatacgttatgcggcggggacgaaagacatgttggagaag
tacttcaagggagaagacttccttgctcagaattacattgtcaaggatggtgtgattgct
cctcagtacatgtaa

DBGET integrated database retrieval system