KEGG   Brassica napus (rape): 106368407Help
Entry
106368407         CDS       T04128                                 

Definition
(RefSeq) beta-glucosidase 16 isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00500  Starch and sucrose metabolism
bna00940  Phenylpropanoid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106368407
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106368407
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    106368407
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     106368407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 106368407
NCBI-ProteinID: XP_013663817
AA seq 514 aa AA seqDB search
MRSKCLLLLLLINLACIGVLAKNHSSRPRLRRNDFPEDFIFGSATSAYQCEGAAHEDGRG
PSIWDTFSEKFPEKIKDGSNGSIADDSYNLYNEDVDLLHQIGFDAYRFSISWSRILPRGD
LKGGINQAGIDYYNNLINLLLSKGVKPFVTLFHWDLPEALEHAYGGFLGSEIVNDFRDYA
ELCFQKFGDRVKHWTTLNEPFTVVHEGYTIGEKAPGRCSSFTNPKCFGGDGATEPYIVGH
NFLLAHGAAVKIYREKYQAIQKGKIGIALNTVWHYPYSDSHADKLAAARATAFTFDYFLE
PIVYGRYPADMVNYVKGGRLPTFTPEESSILKGSYDFVGVNYYSSFYVKDVPCATENITM
NTDSCVSIVGERNGVPIGPAAGSDWLLIYPEGIRDLLLHAKLKFNDPALYVTENGVDEAS
IGEIFLNDDLRIDYYAHHLKMVSDAILMGVNVKGYFAWSLMDNFEWSEGYTVRFGLVFVD
FEDGRKRYLKKSAKWFMRLLKGEYNGMRQKVAVI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaaatgtcttcttttactgttgctcattaatttggcctgcattggagttctc
gccaagaaccactcttcgagacctagactaagaagaaatgattttccagaagattttatt
tttggatctgcgacttctgcatatcagtgtgaaggtgctgctcatgaagatggtagagga
ccaagtatctgggacaccttctctgaaaaattcccagagaagataaaggatggtagtaat
gggtccattgctgatgattcttacaatctttacaatgaagatgtggatttgctgcatcaa
attggcttcgatgcttaccgattctcaatctcctggtcacgaattttgcctcgtggagat
ttaaagggaggtattaaccaagctggaatcgactattacaacaacttgattaatctactt
ctgtctaaaggagtgaagccatttgtcacactttttcactgggacttaccagaggcactt
gaacatgcttacggtggctttcttggatcagagattgtgaatgatttccgagactacgct
gaactctgtttccagaagtttggagatagagtgaagcattggacgacgttaaacgagcca
tttacggtggtacatgaaggttatacaattggtgaaaaggcacctggaagatgttccagt
ttcactaatcctaaatgttttggcggtgatggtgccacggagccttacatcgtcggccat
aacttcctccttgctcatggagccgccgtcaaaatctacagagaaaaataccaggcgatt
cagaaaggtaaaattggtatcgccttgaacacagtatggcactacccttactcagattcc
catgctgacaaattagctgcggctcgagccacggccttcaccttcgactacttcttggag
ccaatcgtctatggtagatacccggccgacatggtcaattatgtgaaaggcggtcgtctt
cctacattcacaccagaagagtcctccatcctcaaaggatcgtatgatttcgtaggcgtt
aactattactcatctttttacgtcaaagatgtgccgtgtgcaaccgaaaacatcaccatg
aacaccgattcttgcgtcagcatcgttggtgagcgaaatggagtacccatcggtccagcg
gctgggtcggattggcttttgatttaccctgagggtattcgtgatcttctactacatgcc
aaactcaaattcaatgatcctgccttgtatgtaacagaaaacggagttgatgaagcaagc
attggagaaatctttcttaatgacgacttgagaattgactactacgctcatcaccttaag
atggttagcgatgcaatcttgatgggggtgaatgtgaaaggatattttgcatggtcgctg
atggataatttcgaatggtcggaaggatacacggttcggttcggactagtgtttgtggac
tttgaagatggacgtaagaggtatctgaagaaatcagctaagtggtttatgagattgttg
aagggagagtataatgggatgaggcagaaggtggctgttatttaa

DBGET integrated database retrieval system