KEGG   Brassica napus (rape): 106368417Help
Entry
106368417         CDS       T04128                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00670  One carbon pool by folate
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106368417
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106368417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 106368417
NCBI-ProteinID: XP_013663828
UniProt: A0A078HWP8
AA seq 592 aa AA seqDB search
MKVVDKIKSATEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPSFCDITWGAGGSTA
DLTLEIASRMQNAICVETMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGEDK
FVQVEGGFACALDLVNHVRSKYGDYFGITVAGYPEAHPDVIEADGLATPESYQSDLAYLK
KKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNEEAVKAFGIHFATEMCKKILAHGITTLHIYTLNMDKSAIGILMNL
GLIDESKITRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPQGRWGDSRSA
SYGTLSDYQFMRPRARDKKLQQEWVVPLKGIEDVQEKFKELCLGSLKSSPWSELDGLQPE
TKIINEKLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSRDKLD
TIVEKSKAFPSITYMAVNKAGNWVSNVGEADVNAVTWGVFPAKEIIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYFLVSLVDNDYINGDIFSVFA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagtcgacaagatcaaatccgcgacggagcaaggccaaaccgccttctccttc
gaattcttcccgccgaagaccgaagatggcgtcgagaatctcttcgaacggatggatcgt
ctggtctcgtacggaccttccttctgcgacatcacctggggcgccggaggatccaccgcc
gatctcacgctcgagatcgcctcgaggatgcagaacgcgatctgcgtggagacgatgatg
catctcacctgcaccaacatgcctgtggagaagatcgaccacgcgctcgagacgattaga
tccaacgggattcagaacgtgctcgcgcttagaggggacccgcctcatggggaggataag
ttcgttcaggtggaaggagggttcgcttgtgcgttggatctggtgaatcatgttaggagc
aagtatggtgattactttgggatcactgttgctggttatcccgaggctcatccggatgtg
attgaagctgatgggcttgcgactcctgagtcttatcagagtgatcttgcttatctgaag
aaaaaggttgatgctggagcggatctgattgtgactcagctgttttatgatactgatatt
ttcctcaagtttgtgaatgactgtcggcaaattgggattaattgtcccattgttcctggg
attatgcccatttctaactacaaggggttcttgcgtatggctggtttctgcaagaccaag
atacctgctgagctcactgctgcgttggagcctatcaaggataatgaagaagctgttaag
gcctttggtattcactttgcaacagaaatgtgcaaaaagattttggctcatggaatcact
acccttcatatctacaccttgaacatggacaaatcagctattgggatattaatgaacctt
ggtctgattgatgagtcaaaaattactcgttctttaccttggagacgccctgcaaatgtt
ttccgaactaaggaagatgttcgccccattttctgggcaaaccgtccaaagagctacata
tctagaacaaaaggctggaacgacttcccacagggacggtggggtgattctcgcagtgca
tcgtatggtacactttcggattatcagttcatgcgcccacgtgcacgtgacaagaagctt
cagcaagaatgggtcgtcccattgaaaggcattgaagacgttcaagagaaattcaaggag
ctctgccttggaagcttaaaaagcagtccgtggtctgagttagatggactccagccagag
acaaagatcataaacgaaaagctcggcaaaatcaactccaacggcttcttgaccatcaat
agccaaccatcagtcaacgcagcgaaatctgattctccagctattggatggggtggtcct
ggtggatacgtctaccagaaagcttacctagagttcttctgctcaagggataagctagac
acaattgtggagaaatccaaagcttttccttccatcacctacatggccgtgaacaaagca
gggaactgggtatcaaacgttggtgaagccgatgtgaacgcagttacttggggagtgttc
ccagccaaggagattattcaaccgacaatcgtggatccagccagtttcaaagtctggaaa
gacgaagccttcgagatttggtcaagaagctgggctaacttgtacccagaggatgaccct
tctagaaagttgctcgaggaggtgaaaaacagctacttcctggtgagcttagtggacaac
gactacatcaatggtgatatattctccgtctttgcttga

DBGET integrated database retrieval system