KEGG   Brassica napus (rape): 106368434Help
Entry
106368434         CDS       T04128                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK1
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
bna  Brassica napus (rape)
Pathway
bna04016  MAPK signaling pathway - plant
bna04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:bna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    106368434
   04075 Plant hormone signal transduction
    106368434
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106368434
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106368434
Protein kinases [BR:bna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106368434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase Pkinase_fungal APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 106368434
NCBI-ProteinID: XP_013663851
AA seq 389 aa AA seqDB search
MEPPNNAEPAETDGGATTDLQPHPPPENIYMNLSHDGRYIKHNFSGNIFEVTAKYKPLIR
LLGRGGGGIVCSGINSETNEKVAIKKIACRDQITAKRTLREIKLLRHLEHENIVGIKDIV
LPPQRDAFEDVYIAYELMDTDLEKLIKSNQELTKYHHQFYMYQLLRGLKYIHSANVLHRD
LTPGNILLNANSELKICDFGLARVASDAMTQYVGTKWYRAPELLLSSSAYTSAIDVWSVG
CIFLEMMTRTPLFPGRDRSDQLRSILEFLGSPTEDDTGSLNESGKQCLKMLPWFDRQSFF
VKFPDVPFLAVLLLEKMLKFDPRKRISVEDALADPYFKTMHNINNEPVCTKLFDFDLEEH
PLTVEQIKELIYHEALAFNPEPATVEKDQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaccacctaacaatgctgagccggcggaaactgacggtggagctactaccgacctt
cagccgcatccgccacctgagaatatttatatgaatctcagccatgacggaaggtatata
aaacacaacttttctggcaatatcttcgaagtcacggcaaagtataagccattgatcagg
cttcttggtagaggtggtggtggcatcgtttgttccggtataaactcggagaccaatgag
aaggtagcaataaagaaaattgcatgtagagaccaaatcactgcaaagagaactctccgt
gaaatcaagcttcttcgtcacttagagcatgaaaacattgtaggaatcaaagacatagta
ttgcctcctcagagagatgcttttgaagatgtttacattgcttatgaattgatggacact
gaccttgagaaactcataaagtccaatcaagaactaaccaaatatcatcaccagttttac
atgtatcaactcctgcgtggactaaaatacattcattcagccaatgtgttacatagagat
ttaacaccgggcaatatcctcctgaatgcgaacagtgaattaaagatctgtgatttcggg
cttgctcgtgttgcttcagacgcaatgactcagtatgttggcacaaaatggtaccgcgca
ccagagcttctcttgagctcttctgcttatacctcagctatagatgtttggtctgttggc
tgtattttcttggagatgatgactcgcacaccgctcttccctggaagagatcgttccgat
cagcttcgttcgattctagagttcttaggctctccaaccgaggatgacactggatcgttg
aatgaaagtggtaagcaatgcttaaagatgcttccttggtttgatcgccagtctttcttt
gtaaagttcccagacgttcctttcttagctgttctgttgttggagaagatgctcaagttt
gaccctagaaagagaatctcagttgaggatgcacttgctgatccatatttcaaaacgatg
cacaacattaacaatgaaccagtgtgcacgaagctctttgactttgatttagaggaacat
ccactcacagtggagcagatcaaggagctgatctaccatgaagccctagctttcaaccct
gaaccagcaacagttgaaaaagaccaatga

DBGET integrated database retrieval system