KEGG   Brassica napus (rape): 106368745Help
Entry
106368745         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.1, cofactor of APC complex
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106368745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106368745
   03036 Chromosome and associated proteins [BR:bna03036]
    106368745
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106368745
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106368745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106368745
NCBI-ProteinID: NP_001303176
UniProt: O82669
AA seq 457 aa AA seqDB search
MDAGMNTSTHLKAQARCPLQEHFLPRKSSKENLDRFIPNRSAMDFDYAHYALTEGRNGKD
QAAAAVSSPSREAYRKQLAETMNLNHTRILAFRNKPQAPVELLPTDHSASLHQQPRSVKP
RRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALGHTVYLWDASSGSTSELVTIDE
EKGPVTSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGTMAWNNHILTT
GGMDGQIVNNDVRIRSHVVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASS
NSTTQYLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQ
VCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVATA
AGDETLRFWNVFGVPETAKKAAPKAAHEPFSHVNRIR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtatgaacacatctacgcacttgaaggctcaagctcgttgccctcttcaa
gaacacttccttcccaggaagagttccaaggaaaaccttgacagattcatacccaacaga
tcagccatggacttcgactatgctcactacgcccttaccgaaggaaggaacgggaaagat
caggcagcagcagcggtaagctcaccatccagagaggcctacaggaagcaactcgctgag
acgatgaacctgaaccacactcggattctcgccttcagaaacaaacctcaagctccagtc
gagttgcttcccaccgaccactctgcttctcttcaccaacagcccagatccgttaagcct
cgtagatacattcctcagacctctgagaggacattggatgcacctgacatcgttgacgac
ttctacctcaacctgcttgactggggcagtgctaatgtcctagccattgcgttgggacac
actgtttatctgtgggatgcttccagcgggtccacttctgagcttgtcaccattgatgag
gagaaaggacctgtcacgagtatcaactgggcacctgatggtcgtcatgttgcagttggg
ctcaacaactctgaagtccagctttgggattctgcatccaaccgtcaactgaggacattg
aagggtggccaccagtctagagtaggaacaatggcatggaacaatcacatcctgacaaca
ggaggaatggatggacagatcgtcaacaacgacgtgcgaatcagatcacacgttgtggaa
acttacagaggtcacactcaggaagtttgcgggctcaagtggtcaggatccggacagcag
ctagcgagtggtggcaacgacaatgtggtacacatatgggatcgttctgtcgcctcctca
aactcgaccactcaatatctgcacaggcttgaagaacatacatctgcggttaaagccctt
gcgtggtgccctttccaagcgaatcttcttgcaactggtggtggcggaggagataggacg
ataaagttctggaacactcacacaggagcttgcttgaattcagtagacactggctcccaa
gtttgttcgctgttatggagcaagaatgaaagagagttgcttagctcacacgggtttaca
cagaaccagcttacgttgtggaagtacccatctatggtgaaaatggctgagctcactggt
catacgtcaagagttctatacatggctcagagtccagatggttgcaccgtagctacagca
gcaggagatgaaacgctgagattctggaatgttttcggagtgccagagacggccaagaaa
gcagctccaaaggcagctcatgagccgttttctcatgtgaaccgtattcgttga

KEGG   Brassica napus (rape): 106371580Help
Entry
106371580         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106371580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106371580
   03036 Chromosome and associated proteins [BR:bna03036]
    106371580
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106371580
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106371580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106371580
NCBI-ProteinID: XP_013667116
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGKIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaagattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatgcatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106382052Help
Entry
106382052         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106382052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106382052
   03036 Chromosome and associated proteins [BR:bna03036]
    106382052
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106382052
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106382052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106382052
NCBI-ProteinID: XP_013677464
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGNIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKTDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaacattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatgcatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaaactgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106382523Help
Entry
106382523         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106382523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106382523
   03036 Chromosome and associated proteins [BR:bna03036]
    106382523
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106382523
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106382523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106382523
NCBI-ProteinID: XP_013678006
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGNIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaacattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatgcatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106382524Help
Entry
106382524         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106382524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106382524
   03036 Chromosome and associated proteins [BR:bna03036]
    106382524
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106382524
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106382524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106382524
NCBI-ProteinID: XP_013678007
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGNIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaacattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatgcatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106382525Help
Entry
106382525         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106382525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106382525
   03036 Chromosome and associated proteins [BR:bna03036]
    106382525
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106382525
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106382525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106382525
NCBI-ProteinID: XP_013678008
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGNIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaacattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatgcatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106382526Help
Entry
106382526         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106382526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106382526
   03036 Chromosome and associated proteins [BR:bna03036]
    106382526
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106382526
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106382526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106382526
NCBI-ProteinID: XP_013678009
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGKIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHTSRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaagattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatacatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106397054Help
Entry
106397054         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106397054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106397054
   03036 Chromosome and associated proteins [BR:bna03036]
    106397054
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106397054
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106397054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106397054
NCBI-ProteinID: XP_013693049
AA seq 211 aa AA seqDB search
MDGKIVNNDVRIRSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRW
LHRLEEHTSAVKALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLW
SKNDRELLSSHGFSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESL
RFWDVFGMPDTAKKPDQKAAHEPFSPVPRIR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaagattgtcaacaacgatgtcaggatcaggtcgcatgttgtgggaacttac
agaggtcacactggagagatttgtggactcaagtggtcaggttctggaatgcagcttgct
agtggtggcaacgataatgtggttcacgtatgggatcgctcttctgcgtcttcgagatgg
ctgcacaggcttgaggaacatacttctgccgtgaaagctcttgcttggtgccccttccaa
tcgaatttgcttgcaactggtggtggtggaacagatggggcgatcaagttctggaacact
cacaccggagcttgcttgaactctgtagacacaggatcccaagtgtgtgctttgttgtgg
agcaagaatgacagagagttgcttagctcacatgggttttctcagaaccaccttgcactt
tggaagtacccatccttggtgaaaatggctgagctcactggccatgcatcaagagttctg
tatatgacacagagtcctgatggctctaccgttgcttcagctgcaggagacgagagtttg
aggttttgggatgtttttggaatgccagacactgccaaaaaacctgatcagaaagcagcc
catgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106397741Help
Entry
106397741         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106397741
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106397741
   03036 Chromosome and associated proteins [BR:bna03036]
    106397741
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106397741
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106397741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106397741
NCBI-ProteinID: XP_022560699
AA seq 427 aa AA seqDB search
MNTCRIVLQRRFLPVSNSKKEKFDRFIPNRAAMDFDYAHLALMEEREEEEEVSSSRKAYR
KQLAETMGLNRTRILAFTNKPPSSTSLHHQHQHQHEPPRRIPQRPERTLDAPGLVDDFYL
NVLDWSSANVLAVALANSVCLWDASTGSVTTLVTYGEDQGPVTSLNWAHDGINLGVGLNN
GQVHIWDCVTKTLLRTLQGFHHTRVGSLAWNTHILTTGGMDGRIFNNDVRFMSYPVSTYK
GHTQEVCGLKWSASGQQLASGGNDRLVHIWDRSTSTQWLHRLRGHTSAVKALAWCPFQSD
LLASGGGAEDRKIKFWNTRTGACLNSLDTASQVSSLLWSNNQRELLCSHGSQLTLWKYPS
MVKMAELSGHTSRVLSMTQSPDGCTVVSAAGDENLCFWNVFGLPHTTAKKTVPKAAHEPF
SHVARIR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttgtcgaatagttctccaacgcaggttccttcccgtgagcaactccaagaag
gaaaaatttgacagattcataccgaacagagcagccatggatttcgactatgctcacttg
gctcttatggaagaaagagaagaagaagaagaggtcagttcatccagaaaagcttataga
aagcaattggctgagactatgggtcttaaccgaactcgaatcctcgcattcaccaacaaa
ccaccttcttctacttctcttcaccatcagcatcagcatcagcatgagcctcctcgacgc
attcctcagcgtcccgagagaactttggatgctcctggccttgtggatgacttctatctc
aacgttctcgactggagcagtgctaatgtcctagccgttgccttggccaactctgtttgt
ctctgggatgcttccactggctccgtgactacgcttgtcacgtatggtgaagaccaagga
cctgtcacaagtctaaactgggcgcatgatggtatcaaccttggagttgggctcaacaat
ggtcaagttcacatttgggactgtgtaaccaagactctactgagaacattgcaaggcttc
caccacacacgagttgggtccttggcctggaacactcatatattgacaaccggaggaatg
gacggacgtatcttcaacaacgatgtgcggttcatgtcataccctgtgtctacttacaag
ggtcacactcaagaggtctgtgggctcaagtggtcagcatctggtcagcaactagctagc
ggcggaaacgaccgtctagtacatatatgggatcgttctactagtacgcagtggctgcac
aggctcagggggcatacatctgcagttaaggctctcgcttggtgtcctttccaaagcgat
ttgcttgcatctggcggtggtgcagaagataggaagatcaagttctggaacactcgcaca
ggggcttgcttgaattcgcttgacactgcttcccaagtctcttctctcttgtggagcaac
aatcaaagagagctgctttgctcacatgggtctcagctcacactgtggaagtacccgtcg
atggtgaaaatggctgagctctctggtcatacgtcaagagttctatctatgacccagagt
ccagatggttgtactgtagtttcagctgcaggagacgagaatctgtgcttttggaatgtt
tttggactacctcacaccaccgccaaaaaaactgttccaaaagcagctcatgagccgttt
tctcatgtcgctcgtattcgttga

KEGG   Brassica napus (rape): 106397859Help
Entry
106397859         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106397859
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106397859
   03036 Chromosome and associated proteins [BR:bna03036]
    106397859
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106397859
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106397859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106397859
NCBI-ProteinID: XP_013693938
AA seq 426 aa AA seqDB search
MNTCRIVLQRRFLPVSNSKKEKFDRFIPNRSAMDFDYAHLALMEEEEEEEVSSSRKAYRK
QLAETMGLNRTRILAFTNKPPSTSSLQHQHQHQHQPPRRIPQRPERTLDAPGLVDDFYLN
VLDWSSANVLAVALANSVCLWDASTGSVTTLVTYGEDQGPVTSLNWAHDGINLGVGLNNG
QVHIWDCVTKTLLRTLQGFHHTRVGSLAWNTHILTTGGMDGRIFNNDVRFMSYPVSTYKG
HTQEVCGLKWSGSGQQLASGGNDRLVHIWDRSTCTQWLHRLRGHTSAVKALAWCPFQSDL
LASGGGAEDRKIKFWNTRTGACLNSLDTASQVSSLLWSNNQRELLCSHGSQLTLWKYPSM
VKMAELSGHTSRVLSMTQSPDGCTVVSAAGDENLCFWNVFGLPDTTAKKTVPKAAHEPFS
HVARIR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttgtcgaatagttctccaacgcaggttccttcccgtgagcaactccaagaag
gaaaaatttgacagattcataccgaacagatcagccatggatttcgactatgctcacttg
gctcttatggaagaagaagaagaagaagaggtcagttcatccagaaaagcttatagaaag
caattggctgagactatgggtcttaaccgaactcgaatcctcgcattcaccaacaaacca
ccttctacttcttctcttcagcatcagcatcagcatcagcatcagcctcctagacgcatt
cctcagcgtcccgagagaactttggatgctcctggccttgtggatgacttctatctcaac
gttctcgactggagcagtgctaatgtcctagccgttgccttggccaactctgtttgtctc
tgggatgcttccactggctccgtgactacgcttgtcacgtatggtgaagatcaaggacct
gtcacaagtctaaactgggcacatgatggtatcaaccttggagttgggctcaacaatggt
caagttcacatttgggactgtgtaaccaagactctactgagaacattgcaaggcttccac
cacacacgagttgggtccttggcctggaacactcatatattgacaaccgggggaatggac
ggacgtatcttcaacaacgatgtgcggttcatgtcataccctgtgtctacttacaagggt
cacactcaagaggtctgtgggctcaagtggtcaggatctggtcagcaactagctagcggc
ggaaacgaccgtctagtacatatatgggatcgttctacttgtacgcagtggctgcacagg
ctcagggggcatacatctgcagttaaggctctcgcttggtgtcctttccaaagcgatttg
cttgcatctggcggtggtgcagaagataggaagatcaagttctggaacactcgcacaggg
gcttgcttgaattcgcttgacactgcttcccaagtttcttctctcttatggagcaacaat
caaagagagctgctttgctcacatgggtctcagctcacactgtggaagtacccatcgatg
gtgaaaatggctgagctctctggtcatacgtcaagagttctatctatgacccagagtcca
gatggttgtactgtagtttcagctgcaggagacgagaatctgtgcttttggaatgttttt
ggactacctgacaccaccgccaaaaaaactgttccaaaagcagctcatgagccgttttct
catgtcgctcgtattcgttga

KEGG   Brassica napus (rape): 106411477Help
Entry
106411477         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.1, cofactor of APC complex
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106411477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106411477
   03036 Chromosome and associated proteins [BR:bna03036]
    106411477
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106411477
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106411477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106411477
NCBI-ProteinID: XP_013707700
AA seq 453 aa AA seqDB search
MDAGMNTSTHLKAQARCPLQEHFLPRKNSKENLDRFIPNRSAMDFDYAHYALTEGNKGKD
QVSSPSREAYRKQLAETMNLNHTRILAFRNKPLAPVELLPTDHSASLHQQPKSVKPRRYI
PQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALGHTVYLWDASTGSTSELVTVDEEKGP
VTSINWAPDGRHVAVGLNNSEVQLWDSGSNRQLRTLKGCHQSRVGSLAWNNHILTTGGMD
GQIVNNDVRIRSHIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTT
QWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSL
LWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDE
TLRFWNVFGVPETAKKAAPKAVHEPFSHVNRIR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtatgaacacatctacgcacttgaaggctcaagctcgttgccctcttcaa
gaacacttccttccccgcaaaaattccaaggaaaatctggacagattcataccaaacaga
tcagctatggattttgactacgctcactacgctctcaccgaaggaaacaaaggtaaggat
caggtaagctcgccatccagagaggcctacaggaagcaactcgctgagacgatgaacctg
aaccacaccaggatcctcgccttcaggaacaaacctctagctcctgttgagttgcttccc
accgaccactctgcttctctccaccagcaacccaaatccgttaagccaagaagatatatt
cctcagacttctgagaggacattggacgcgcctgacattgtggatgacttttatctcaac
ttgcttgactggggaagtgctaatgtcttggccattgcgttgggacacactgtttatctc
tgggatgcttccactggctccacttctgagcttgtcaccgttgatgaggagaaaggacca
gtcacgagtatcaactgggcgcctgatggtcgtcatgttgctgttggactcaacaactcc
gaagtccagctgtgggattctggttccaaccgtcaactgagaacattgaaaggttgccac
cagtcaagagtaggatccttggcatggaacaaccacatcctcacaacgggagggatggac
ggacagatcgttaacaacgacgtgcgcatcagatcacatatcgtggagacttacaggggc
cacactcaagaggtttgcgggctcaagtggtcgggatccggacagcagctagcgagcggc
ggcaacgacaatgtggtacacatatgggaccgttccgtggcctcctcgaactcgaccacg
cagtggctgcacaggcttgaggagcatacgtctgctgtgaaggctcttgcgtggtgccct
ttccaggcgaatttgctggcgactggcggcggtggaggagataggacgattaagttctgg
aacactcacaccggggcttgtttgaactcggtggacactggctcacaagtttgttcgttg
ttgtggagcaagaatgaaagagagttgcttagctcgcatgggtttacgcagaaccagctt
acgttgtggaagtatccgtcgatggtgaagatggctgagctcactggtcatacgtcaaga
gttctatatatggcccagagtccagatggttgtacagtagcttcagcagcaggagacgag
actttgaggttctggaatgtattcggagtaccagagacggctaaaaaagcagctccaaaa
gcagtccacgagccattttctcatgtgaaccgtattcgttga

KEGG   Brassica napus (rape): 106438519Help
Entry
106438519         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.1, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106438519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106438519
   03036 Chromosome and associated proteins [BR:bna03036]
    106438519
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106438519
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106438519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106438519
NCBI-ProteinID: XP_013735165
AA seq 458 aa AA seqDB search
MDAGMNTSTHLKAQARCPLQEHFLPRKSSKENLDRFIPNRSAMDFDYAHYALTEGRNGKD
QVTAAVSSPSREAYRKQLAETMNLNHTRILAFRNKPQAPVELLPTDHSASLLHQQPKSVK
PRRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALGHTVYLWDASSGSTSELVTID
EEKGPVTSINWAPDGRHVALGLNNSEVQLWDSGSNRQLRTLKGCHQSRVGSLAWNNHILT
TGGMDGQIVNNDVRIRSHVVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSAAS
SNSTTQYLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGS
QVCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVAS
AAGDETLRFWNVFGVPETAKKAAPKATHEPFSHVNRIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtatgaacacatctacgcacttgaaggctcaagctcggtgcccacttcaa
gaacacttccttccccggaagagttccaaggaaaaccttgacagattcattcccaacaga
tcagccatggacttcgactatgctcactacgctcttaccgaaggtaggaacgggaaagat
caggtaacagcagcggtaagctcaccgtccagagaggcctacaggaagcaactcgctgag
acgatgaacctgaaccacactcggattctcgccttcagaaacaaacctcaagctccagtc
gagttgcttcctacagaccactctgcttctcttcttcaccaacagcccaaatccgttaag
cctcgcagatacattcctcagacttctgagagaacattggatgcacctgacattgtggac
gacttctacctcaacttgcttgactggggcagtgctaatgtccttgccattgcgttggga
cacactgtttatctgtgggatgcttccagcgggtccacttctgagcttgtcaccattgat
gaggagaaaggacctgtcacgagtatcaactgggcacctgatggtcgtcatgtcgcactt
ggactcaacaactccgaagtgcagctgtgggattctggatccaaccgtcaactgaggaca
ttgaagggttgccaccagtctagagtaggatcattggcgtggaataatcacatcctgacg
acgggagggatggatggacagatcgtcaacaacgacgtgcgaatcagatcacacgttgtg
gaaacttacagaggtcacactcaagaggtctgcgggctaaagtggtcaggatccggacag
caactagcgagtggtggcaacgacaatgttgtacacatatgggatcgttcagccgcctct
tcaaactcgaccactcagtatttgcacaggctcgaagaacatacgtctgcagttaaagcc
cttgcgtggtgccctttccaagcgaatttgcttgctactggtggtggcggaggagatagg
acgataaagttctggaacactcacacaggagcttgcttgaattcagttgacaccggctcc
caagtttgttctttgttgtggagcaagaacgaaagagagttgcttagctcacacgggttt
acacagaatcagcttacgttgtggaagtacccatctatggtgaaaatggctgagctcact
ggtcatacatcaagagttctatacatggcccagagcccagatggttgtaccgtggcttca
gcagcaggagatgaaactctgagattctggaatgttttcggagtaccagagacggccaaa
aaagcagctccaaaagcaactcatgagccgttttctcatgtgaaccgtattcgctga

KEGG   Brassica napus (rape): 106443822Help
Entry
106443822         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106443822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106443822
   03036 Chromosome and associated proteins [BR:bna03036]
    106443822
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106443822
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106443822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106443822
NCBI-ProteinID: XP_013740833
AA seq 203 aa AA seqDB search
DVRIRSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHT
SAVKALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELL
SSHGFSQNHLALWKYPSLVKMAELTGHASRVLYMTQSPDGSTVASAAGDESLRFWDVFGM
PDTAKKPDQKAAHKPFSPVPRIR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gatgtcaggatcaggtcgcatgttgtgggaacttacagaggtcacactggagagatttgt
ggactcaagtggtcaggttctggaatgcagcttgctagtggtggcaacgataatgtggtt
cacgtatgggatcgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatact
tctgccgtgaaagctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggt
ggtggaacagatggggcgatcaagttctggaacactcacaccggagcttgcttgaactct
gtagacacaggatcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgctt
agctcacatgggttttctcagaaccaccttgcactttggaagtacccatccttggtgaaa
atggctgagctcactggccatgcatcaagagttctgtatatgacacagagtcctgatggc
tctaccgttgcttcagctgcaggagacgagagtttgaggttttgggatgtttttggaatg
ccagacactgccaaaaaacctgatcagaaagcagcccataagccattttctcccgtgcct
cgtatccgttga

KEGG   Brassica napus (rape): 106446417Help
Entry
106446417         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106446417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106446417
   03036 Chromosome and associated proteins [BR:bna03036]
    106446417
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106446417
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106446417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106446417
NCBI-ProteinID: XP_013743590
AA seq 439 aa AA seqDB search
MNAGMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKKEARELSPSK
EAYRKRLAETLGLNRTRILAFRNKPQPPLHSHYHSASLHQQPLKPRRRRIPQSCSKVLDA
PNILDDFYLNLLDWGSRNVLAIALGHTLCLWDASTGSVSEFVTIEEDQGPITSISWAPDG
SHVALGLNNSQVQLWDSSSIRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGKIINNDVRI
RSHVVGTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASSRWLHRLEEHTSAVK
ALAWCPFQSNLLATGGGGTDGAIKFWNTHTGACLNSVDTGSQVCALLWSKNDRELLSSHG
FSQNHLALWKYPSLVKMAELTGHTSRVLYMTQSPDGSTVASAAGDESLRFWDVFGMPDTA
KKPDQKAAHEPFSPVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgaactggaaggaacatggtcggaagattcccaaggaaaatctggac
agattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcaccgaa
gccctaatcgaagcaagagacggcaaaaaaaaagaagcgcgggagctttcaccctccaaa
gaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctcgcc
ttcaggaacaaacctcaacctcctctccactctcattatcactctgcttctcttcaccaa
caacctctaaagcctcgccgccgacgcattcctcagtcttgtagcaaagtcttggatgct
cctaacattcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtctta
gctattgccttgggccacactctttgcctctgggatgcttctaccggctctgtatccgag
ttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgatggt
tcccacgttgcacttggcctcaacaactctcaagtccagctttgggattcttcatccatc
cgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcatggaac
aatcacatcctcacaaccggaggaatggacgggaagattatcaacaacgatgtcaggatc
aggtcgcatgttgtgggaacttacagaggtcacactggagagatttgtggactcaagtgg
tcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgggat
cgctcttctgcgtcttcgagatggctgcacaggcttgaggaacatacttctgccgtgaaa
gctcttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaacagat
ggggcgatcaagttctggaacactcacaccggagcttgcttgaactctgtagacacagga
tcccaagtgtgtgctttgttgtggagcaagaatgacagagagttgcttagctcacatggg
ttttctcagaaccaccttgcactttggaagtacccatccttggtgaaaatggctgagctc
actggccatacatcaagagttctgtatatgacacagagtcctgatggctctaccgttgct
tcagctgcaggagacgagagtttgaggttttgggatgtttttggaatgccagacactgcc
aaaaaacctgatcagaaagcagcccatgagccattttctcccgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 106451281Help
Entry
106451281         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106451281
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    106451281
   03036 Chromosome and associated proteins [BR:bna03036]
    106451281
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     106451281
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    106451281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 106451281
NCBI-ProteinID: XP_013748641
AA seq 439 aa AA seqDB search
MNAGMMNWKEHGRKIPKENLDRFIPNRSAMDFDFAHHALTEALIEARDGKKEEPLELSPS
KEAYRKRLAETLGLNRTRILAFRNKPQPPPHSHYYSHHQQQQQKPRRRRRIPQSCSKVLD
APNMLDDFYLNLLDWGSRNVLAIALGHTLYLWDASTGSVSEFVTIEEDQGPITSISWAPD
GSHVALGLDNSQVQLWDSSSNRKIRTLNGVHHSRVGSLAWNNHILTTGGMDGMIVNNDVR
IRSHVVDTYRGHTGEICGLKWSGSGMQLASGGNDNVVHVWDRSSASPTHRLEEHTSAVKA
LAWCPFQSNLLATGGGGIDGAIKFWNTHTGACLNSLDTGSQVCALLWSKNDRELLSSHGF
SHNHLALWKYPSLVKMAELTGHTSRVLYMTQSPDGCTVASAAGDESLRFWDVFGMPETAK
KPDQKAAAHEPFSRVPRIR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgatgaactggaaggaacatggtcggaagattcccaaggaaaatctg
gacagattcataccgaacagatcagctatggatttcgactttgctcatcacgccctcacc
gaagccctaatcgaagcaagagacggcaaaaaagaagaaccgctggagctctcaccctcc
aaagaggcttacaggaagcgtttggcggaaacgctcggtctcaaccgcacccgtattctc
gccttcaggaacaaacctcaacctcctccccactctcattattactctcaccaccaacaa
caacaacaaaagcctcgccgacgacgacgcattcctcagtcttgtagcaaagtcttggat
gctcccaacatgcttgacgacttctacctcaacttgcttgactggggttctcgtaacgtc
ttagctattgccttgggccacactctttacctctgggatgcttctaccggctctgtatct
gagttcgtgaccattgaggaagaccaaggacccatcacaagcataagctgggcacctgat
ggttcccacgttgcacttggcctcgacaactctcaagtccagctttgggattcttcatcc
aaccgcaagataagaactttgaacggtgtccaccactctagagtaggatcacttgcgtgg
aacaatcacatcctcacaaccggaggaatggacgggatgattgtcaacaacgatgtcagg
atcaggtcgcatgttgtggacacttacagaggtcacactggggagatttgtggactcaag
tggtcaggttctggaatgcagcttgctagtggtggcaacgataatgtggttcacgtatgg
gatcgctcttctgcgtctcccacgcacaggcttgaggaacatacttctgccgttaaagct
cttgcttggtgccccttccaatcgaatttgcttgcaactggtggtggtggaatagatggg
gcgatcaagttctggaacactcacaccggagcttgcttgaactctctagacacaggatcc
caagtgtgtgctttgttgtggagcaagaatgatagagagttgcttagctcacatgggttt
tctcacaaccaccttgcgctttggaagtacccatccttggtgaaaatggctgagctcact
ggccatacgtcaagagttctgtatatgacacagagtcctgatggctgtaccgttgcttct
gcagcaggagacgagagtttgaggttttgggatgtttttggaatgccagagactgccaaa
aaacctgatcagaaagcagcagcccatgagccattttctcgcgtgcctcgtatccgttga

KEGG   Brassica napus (rape): 111208183Help
Entry
111208183         CDS       T04128                                 

Definition
(RefSeq) cell division cycle 20.2, cofactor of APC complex-like
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bna  Brassica napus (rape)
Pathway
bna04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111208183
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bna04121]
    111208183
   03036 Chromosome and associated proteins [BR:bna03036]
    111208183
Ubiquitin system [BR:bna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     111208183
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    111208183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 111208183
NCBI-ProteinID: XP_022562697
AA seq 453 aa AA seqDB search
MDAGMNTSTHLKAQARCPLQEHFLPRKNSKENLDRFIPNRSAMDFDYAHYALTEGNKGKD
QVSSPSREAYRKQLAETMNLNHTRILAFRNKPQAPVDLLPTDHSASLHHQPKSVKPRRYI
PQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALGHTVYLWDASTGSTSELVTIDEEKGP
VTSINWAPDGRHVAVGLNNSEVQLWDSGSNRQLRTLKGCHQSRVGSLAWNNHILTTGGMD
GQIVNNDVRIRSHIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTT
QWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSL
LWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDE
TLRFWNVFGVPETAKKAAPKAVHEPFSHVNRIR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtatgaacacatctacgcacttgaaggctcaagctcgttgccctcttcaa
gaacacttccttccccgtaaaaactccaaggaaaatctggacagattcataccaaacaga
tcagctatggacttcgactacgctcactacgccctaaccgaaggaaacaaaggtaaagat
caggtaagctcaccatccagagaggcttacaggaagcaactcgctgagacgatgaacctg
aaccacaccaggatcctcgccttcaggaacaaacctcaagctcctgttgacttgcttccc
accgaccactctgcttctcttcaccaccaacccaaatccgttaagccaagaagatacatt
cctcagacttctgagaggacattggacgcgcctgacattgttgacgacttctacctcaac
ttgcttgactggggaagtgctaatgtcttggccattgctttgggacacactgtttatctc
tgggatgcttccactggttccacttctgagcttgtcactattgatgaggagaaaggacca
gtgacgagtatcaactgggcgcctgatggtcgtcatgttgcagttgggctcaacaactcc
gaagtccagctgtgggattctggatccaaccgtcaactgagaacattgaagggttgccac
cagtctagagtaggatcattggcgtggaacaaccacatcctcacaacgggtggaatggac
ggacagatcgtcaacaacgacgtgcgcatcagatcacatatcgtggagacttataggggc
cacactcaagaggtttgcgggctcaagtggtcaggatccggacagcagctagcgagcggc
ggcaacgacaatgtggtgcacatatgggaccgttctgtggcctcctcgaactcgaccacg
cagtggcttcacaggcttgaggagcatacgtctgctgtgaaggctcttgcgtggtgccct
ttccaggcgaatttgctggcgactggcggcggtggaggagataggacgattaagttctgg
aacactcacacgggggcttgcttgaactcggtggacactggctcacaagtttgttcgttg
ttgtggagtaagaatgaaagagagttgcttagctcgcacgggtttacgcagaaccagctt
acgttgtggaagtacccgtcgatggtgaagatggctgagctcactgggcatacgtcaaga
gttctatatatggcccagagtccagatggttgtaccgtagcttcagcagcaggagacgag
actttgaggttctggaatgttttcggagtaccagagacggccaaaaaagcagctccaaaa
gcagtccacgagccattttctcatgtgaaccgtattcgttga

DBGET integrated database retrieval system