KEGG   Brassica napus (rape): 106370286Help
Entry
106370286         CDS       T04128                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase-like
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
bna  Brassica napus (rape)
Pathway
bna00760  Nicotinate and nicotinamide metabolism
bna01100  Metabolic pathways
Module
bna_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    106370286
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     106370286
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     106370286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 106370286
NCBI-ProteinID: XP_013665778
AA seq 238 aa AA seqDB search
MDVSLPVDKLSTESKPQDKACVVLVATGSFNPPTFMHLRMFELARDALHSEGSHVLGGYM
SPVNDAYEKKGLLSAEHRLKMCNLACKSSDFIMVDPWEASQDSYQRSLMVLSRVKTFLTT
NRRVPEESLKVMLLCGSDLLQSFCTPGVWIPEQVKAICKDYGIVCIRREGQDVESMIFGD
RILYETRDNIRIVNNFVPNQISSSRLRQCISRGLSVKYLTEDGVIDYIKQHQLYTELE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctccttaccagtcgataagctatctactgaatcaaaacctcaggacaaagct
tgtgtagtgcttgtggcaactgggagtttcaaccctcctacgttcatgcatttacgcatg
tttgagctggcaagagatgcattacactcggagggatctcatgttcttggaggctatatg
tcccctgtaaatgatgcatacgagaagaagggacttttatccgcagagcatcgtttaaag
atgtgtaatctagcctgcaaaagctccgactttataatggttgatccttgggaggcatcc
caagacagctaccaacgaagtttgatggttttatctagggtcaagacttttcttacaaca
aatagacgtgtacccgaggaatctctcaaagtcatgctactgtgtggctcggatttactc
caatctttctgcactcccggtgtttggatccctgaacaggtaaaggccatttgcaaagac
tatggcattgtgtgcatccgtagagaaggacaagatgttgaaagtatgatctttggtgac
agaatcctatacgaaacccgtgataacattagaatcgtcaacaactttgttcctaatcag
attagctcaagtagattaaggcaatgcatttcgcgaggactatcagttaagtacttgact
gaagatggagtaatagattatatcaaacaacaccaactttacactgagctcgaatga

DBGET integrated database retrieval system