KEGG   Brassica napus (rape): 106371361Help
Entry
106371361         CDS       T04128                                 

Definition
(RefSeq) cytochrome c oxidase assembly protein COX15
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna00190  Oxidative phosphorylation
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106371361
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106371361
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bna03029]
    106371361
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    106371361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-GeneID: 106371361
NCBI-ProteinID: XP_013666878
AA seq 459 aa AA seqDB search
MFRAVGSVLKRNKESIYGIARGSTSSSHRAFTSNVTSSPLAGNSASSSPLAGNSFNGLRS
LLKGQKAPTFRKMSTLAASSSESKEGLKLLVTGGPQARKWVGTWLFGSAAWVFSMVVLGG
VTRLTRSGLSMTDWKFTGEFPPLSDEAWAKEFEKYKQSPEYKRVNKGMNLEDFKFIYWME
YAHRMWGRGLGIMFALPFSYFLRKGYITLRLGVQLSGLFALGAGQGFIGWWMVKSGLEEP
PSEYSQPRVSPYRLAAHLTSAFAIYCGLFWTALSVVMPEPPAESLAWVRGAAKVKRLALP
VSFIVGITAISGAFVAGNDAGRAFNTFPKMGDTWIPDGIFEMKPLIRNFFENTATVQLDH
RLLATTTLLAIGTMWWFTRKLDIHPAVKALIGSTVGMTAVQVTLGVSTLLSYVPVSLGSA
HQAGALTLLTLMLLLNHTLRRPSPSLLKSLPQVAKSNFS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgcggttggatctgttctgaaaaggaacaaggaatcgatttatggaatcgct
agaggatccacgtcttcgtctcatcgcgctttcacttctaacgtcacatcttctcctcta
gctggaaactccgcttcgtcttctcctctagctggaaactccttcaatggcttgcgatct
ctgctcaaaggtcaaaaggctccaactttcagaaagatgtcaactttagcggcgagtagc
tcagagagtaaagagggtttgaagctgcttgtcactggaggaccccaagctcgcaaatgg
gttggaacatggcttttcggctcagcagcttgggtgttcagcatggtggtactaggcggt
gtaacccggttaactcggtctggtttatccatgactgattggaagttcacaggagagttt
cctcctctgtcagacgaagcttgggctaaggagtttgagaaatataaacagtcacctgag
tataaacgtgtgaacaaaggcatgaatcttgaggatttcaagttcatttattggatggag
tatgctcatcgtatgtggggaagagggttgggaatcatgtttgctttgccgttttcttat
ttcttgcgtaaaggctatattactctacgtcttggagttcagctctctggtttgtttgca
cttggtgctggtcaaggtttcattggttggtggatggttaaaagtggcttagaggagccg
ccgtctgagtattctcagccgagggtaagcccataccgtcttgcagctcacttaacctca
gctttcgccatatattgtggacttttctggaccgctctctctgttgttatgcctgaacca
ccggctgagtcactggcttgggttcggggagcagctaaagtgaagaggcttgcattacca
gtaagcttcattgttggtatcactgccatctctggagcctttgttgctggaaatgatgct
ggtcgtgcatttaacacgttcccgaaaatgggtgatacatggatcccagatggtatattt
gagatgaaaccacttatacgcaacttttttgagaacacagcaactgttcagctcgatcat
cgccttctggcaaccacaacgctactcgcgattggaacaatgtggtggttcacaaggaag
ctagacatacatccagctgttaaggctttgattggaagcactgtcggaatgactgctgtt
caggtgacgttaggtgtatcaactcttctgagttatgttccagtttcactaggaagtgca
caccaagcaggagctttaacacttctcactttgatgttgcttctcaatcacactcttcgg
aggccatcgccttctcttctcaaatctcttccacaagtcgctaagtcaaatttcagctaa

KEGG   Brassica napus (rape): 106377632Help
Entry
106377632         CDS       T04128                                 

Definition
(RefSeq) cytochrome c oxidase assembly protein COX15-like
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna00190  Oxidative phosphorylation
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106377632
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106377632
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bna03029]
    106377632
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    106377632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-GeneID: 106377632
NCBI-ProteinID: XP_022566866
AA seq 276 aa AA seqDB search
MVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYCGLFWTALSVVMPEPPAESLAWVRGA
AKVKKLALPVSFVVGITAISGAFVAGNDAGRAFNTFPKMGDTWIPDGIFEMKPLIRNFFE
NTATVQLDHRLLATTTLLAIGTMWWFTRKLDIHPAVKALIGSTVGMIAVQVTLGVSTLLS
YVPVSLGSAHQAGALTLLTLMLLLNHTLRRPSPSLLKSLPQVASQISAIHQNHSLFLSHL
LKEGERFFYLRDNYAIKFSSNPWSIMLYYQSLVWKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggttaagagcggcttagaggagccgccgtctgagtattctcagccgagggtaagccca
taccgtcttgcagctcacttaacctcagctttcgccatatattgtggacttttctggacc
gctctctctgttgttatgcctgaaccaccggctgagtcgttggcttgggttcggggagca
gctaaagtgaagaagcttgcattacctgtaagcttcgttgttggtatcactgccatctct
ggagcctttgttgctggaaatgatgctggtcgtgcattcaacacgttcccgaaaatgggc
gatacatggatcccagatggtatatttgagatgaaaccacttatacgcaacttcttcgag
aacacagcaactgttcagctcgatcatcgccttctggcgaccactacactgctcgcgatt
ggaacaatgtggtggttcacaaggaagctagacatacatccagctgttaaggctttgatt
ggaagcactgtcggaatgattgctgttcaggtgacgttaggtgtatcaactcttctgagt
tatgttccagtgtcactagggagtgcacaccaagcaggagctttaacacttttgactttg
atgctgcttctcaatcacactcttcggaggccatcgccttctcttctcaaatctcttcca
caagtcgcaagtcaaatttcagctattcaccaaaatcattccctttttctttctcattta
ctaaaagaaggagaacgattcttttatttacgtgataattatgctatcaagttttcatcg
aatccttggtcaattatgttgtattatcaatccttggtttggaaaaaataa

KEGG   Brassica napus (rape): 106380440Help
Entry
106380440         CDS       T04128                                 

Definition
(RefSeq) cytochrome c oxidase assembly protein COX15-like
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna00190  Oxidative phosphorylation
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106380440
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106380440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bna03029]
    106380440
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    106380440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-GeneID: 106380440
NCBI-ProteinID: XP_013675653
AA seq 458 aa AA seqDB search
MFRAVGSVLKRNKESIYGIARGSTSSSHRAFTCNVTSSTTVNSASSSPLAGNSFNGLRSL
LKGQKAPIFRKMSTLAAASSESKEGLKLLVTGGPQARKWVGTWLFCSAAWVFSMVVLGGV
TRLTRSGLSMTDWKFTGEFPPLSDEAWAKEFEKYKQSPEYKRVNKGMNLEDFKFIYWMEY
AHRMWGRGLGIMFALPFSYFLRKGYITLRLGVQLSGLFALGAGQGFIGWWMVKSGLEEPP
SEYSQPRVSPYRLAAHLTSAFAIYCGLFWTALSVVMPEPPAESLAWVRGAAKVKRLALPV
SFIVGITAISGAFVAGNDAGRAFNTFPKMGDTWIPDGIFEMKPLIRNFFENTATVQLDHR
LLATTTLLAIGTMWWFTRKLDIHPAVKALIGSTVGMTAVQVTLGVSTLLSYVPVSLGSAH
QAGALTLLTLMLLLNHTLRRPSPSLLKSLPPVVKSNFS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgcggttggatctgtactgaagaggaacaaggaatcgatttatggaatcgct
cgaggatccacgtcttcgtctcatcgcgctttcacttgtaacgtcacatcttcgactact
gtaaactctgcttcgtcttctcctctagctggaaactccttcaatggcttgcgatctctg
ctcaaaggtcaaaaggctccaattttcagaaaaatgtcgactttagcggcggctagctca
gagagtaaagagggtttgaagctgcttgtcaccggaggaccccaagctcgcaaatgggtc
ggaacatggcttttctgttcagcagcttgggtgttcagcatggtggtactaggcggtgta
acccggttaactcggtccggtttatccatgactgattggaagttcacaggagagttccct
cctctgtcagacgaagcttgggctaaggagtttgagaaatataaacagtcacctgagtat
aaacgtgtgaacaaagggatgaatcttgaggatttcaagttcatatattggatggagtat
gctcatcgtatgtggggaagagggttagggatcatgtttgctttgcctttttcttatttt
ctccgtaaagggtatattactctgcgtcttggagttcagctttctggtttatttgcactt
ggtgctggacaaggtttcattggctggtggatggttaagagcggcttagaggagccgccg
tctgagtattctcagccgagggtaagcccataccgtcttgcagctcacctaacctcagct
ttcgccatatattgtggacttttctggaccgctctctctgttgttatgcctgaaccaccg
gctgagtcgttggcttgggttcggggagcagctaaagtgaagaggcttgcattaccagta
agcttcattgttggtatcactgccatctctggagcctttgttgctggaaatgatgctggt
cgtgcattcaacacattcccgaaaatgggtgatacatggatcccagatggtatatttgag
atgaaaccacttatacgcaacttcttcgagaatacagcaactgttcagcttgatcatcgc
cttctggcaaccacaacgctactcgctatcggaacaatgtggtggttcacaaggaagcta
gatatacatccagctgttaaagctttgattggaagtactgtcggcatgactgctgttcag
gtgacattaggtgtatcaactcttctgagttatgttcccgtttcactagggagtgcacac
caagcaggagctttaacacttctcactttgatgctccttctcaatcacactcttcgcagg
ccatcaccttctcttctcaaatctcttccaccagtcgttaagtcaaatttcagctaa

KEGG   Brassica napus (rape): 106397579Help
Entry
106397579         CDS       T04128                                 

Definition
(RefSeq) cytochrome c oxidase assembly protein COX15-like isoform X1
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna00190  Oxidative phosphorylation
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106397579
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106397579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bna03029]
    106397579
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    106397579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-GeneID: 106397579
NCBI-ProteinID: XP_013693648
AA seq 459 aa AA seqDB search
MFRAVGSVLKRNKESIYGIARGSTSSSHRAFTSNVTSSPLAGNSASSSPLAGNSFNGLRS
LLKGQKAPTFRKMSTLAASSSESKEGLKLLVTGGPQARKWVGTWLFGSAAWVFSMVVLGG
VTRLTRSGLSMTDWKFTGEFPPLSDEAWAKEFEKYKQSPEYKRVNKGMNLEDFKFIYWME
YAHRMWGRGLGIMFALPFSYFLRKGYITLRLGVQLSGLFALGAGQGFIGWWMVKSGLEEP
PSEYSQPRVSPYRLAAHLTSAFAIYCGLFWTALSVVMPEPPAESLAWVRGAAKVKRLALP
VSFIVGITAISGAFFAGNDAGRAFNTFPKMGDTWIPDGIFEMKPLIRNFFENTATVQLDH
RLLATTTLLAIGTMWWFTRKLDIHPAVKALIGSTVGMTAVQVTLGVSTLLSYVPVSLGSA
HQAGALTLLTLMLLLNHTLRRPSPSLLKSLPQVAKSNFS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgcggttggatctgttctgaaaaggaacaaggaatcgatttatggaatcgct
agaggatccacgtcttcgtctcatcgcgctttcacttctaacgtcacatcttctcctcta
gctggaaactccgcttcgtcttctcctctagctggaaactccttcaatggcttgcgatct
ctgctcaaaggtcaaaaggctccaactttcagaaagatgtcaactttagcggcgagtagc
tcagagagtaaagagggtttgaagctgcttgtcactggaggaccccaagctcgcaaatgg
gttggaacatggcttttcggctcagcagcttgggtgttcagcatggtggtactaggcggt
gtaacccggttaactcggtctggtttatccatgactgattggaagttcacaggagagttt
cctcctctgtcagacgaagcttgggctaaggagtttgagaaatataaacagtcacctgag
tataaacgtgtgaacaaaggcatgaatcttgaggatttcaagttcatttattggatggag
tatgctcatcgtatgtggggaagagggttgggaatcatgtttgctttgccgttttcttat
ttcttgcgtaaaggctatattactctacgtcttggagttcagctctctggtttgtttgca
cttggtgctggtcaaggtttcattggttggtggatggttaaaagtggcttagaggagccg
ccgtctgagtattctcagccgagggtaagcccataccgtcttgcagctcacttaacctca
gctttcgccatatattgtggacttttctggaccgctctctctgttgttatgcctgaacca
ccggctgagtcactggcttgggttcggggagcagctaaagtgaagaggcttgcattacca
gtaagcttcattgttggtatcactgccatctctggagccttttttgctggaaatgatgct
ggtcgtgcatttaacacgttcccgaaaatgggtgatacatggatcccagatggtatattt
gagatgaaaccacttatacgcaacttttttgagaacacagcaactgttcagctcgatcat
cgccttctggcaaccacaacgctactcgcgattggaacaatgtggtggttcacaaggaag
ctagacatacatccagctgttaaggctttgattggaagcactgtcggaatgactgctgtt
caggtgacgttaggtgtatcaactcttctgagttatgttccagtttcactaggaagtgca
caccaagcaggagctttaacacttctcactttgatgttgcttctcaatcacactcttcgg
aggccatcgccttctcttctcaaatctcttccacaagtcgctaagtcaaatttcagctaa

KEGG   Brassica napus (rape): 106398887Help
Entry
106398887         CDS       T04128                                 

Definition
(RefSeq) cytochrome c oxidase assembly protein COX15-like isoform X2
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna00190  Oxidative phosphorylation
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106398887
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106398887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bna03029]
    106398887
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    106398887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-GeneID: 106398887
NCBI-ProteinID: XP_013694842
AA seq 235 aa AA seqDB search
MNLEDFKFIYWMEYAHRMWGRGLGIMFALSFSYFMRKGYITLRLGVQLSGLFALGAGQGF
IGRWMVKSGLEELPSEYSQPKLSHWLGFGEQLKVKRLVLPVSFIVGITAISGAFVAGNDA
GRAFNTFPKMGDTWIPDGIFEMKPLIRNFFENTAIVQLDHRLLATTTLLAIGTMWWFTRK
LDIHPAVKALIGSTVGMTAVQVTLGVSTLLSYVPVSLGSAHQAGALTLLTLMLLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaggattttaagttcatatattggatggagtatgctcatcgtatgtgggga
agaggtttagggatcatgtttgctttgtctttttcatattttatgcgtaaagggtatatt
actctacgtcttggagttcagctctctggtttgtttgcacttggtgctggtcaaggtttc
attggtaggtggatggttaaaagtggcttagaggagctgccgtctgaatactctcaacca
aagctgagtcactggcttgggttcggggagcagctaaaagtgaagaggcttgtattacca
gtaagcttcattgttggtatcactgccatctctggagcctttgttgctggaaatgatgct
ggtcgtgcattcaacacgttcccgaaaatgggcgatacatggatcccagatggtatattt
gagatgaaaccacttatacgcaactttttcgagaacacagcaattgttcaactcgatcat
cgccttctggcgaccactacactgctcgcgattggaacaatgtggtggttcacaaggaag
ctagacatacatccagctgttaaggctttgattggaagcactgtcggaatgactgctgtt
caggtgacgttaggtgtatcaactcttctgagttatgttccagtgtcactagggagtgca
caccaagcaggagctttaacacttctcactttgatgttgcttctatag

DBGET integrated database retrieval system