KEGG   Brassica napus (rape): 106372299Help
Entry
106372299         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106372299
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106372299
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106372299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106372299
NCBI-ProteinID: XP_013667933
UniProt: A0A078F9V9
AA seq 439 aa AA seqDB search
MASISNLANLAPATATNSRSSSTSSVLPRSFLNLRSLNAKLSSSSHLSLRHHQTSRPSLF
VRCSASGGNGSAAKRTTLHDLYDKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPAIFQ
KAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVSVEV
SPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIA
RYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAV
AQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVS
TMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFKKSF
ESLLGTLQDKANTLKLASH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttccaatctcgcaaatcttgcacccgccactgctaccaactccagatct
tcttctacttcctccgtcttaccaagatccttcctcaacctccgcagtttgaacgctaag
ctttcctcttcttctcatctctcccttcgtcaccaccaaacatccagaccttccctcttt
gtgaggtgttcagcctctggtggaaacggaagtgctgcaaagagaacgactcttcacgat
ctatacgacaaggaaggtcagagtccttggtatgacaatctttgccgtcccgtcactgat
ctcctccccttcattgcccgtggtgttcgtggcgttactagcaaccctgcgatcttccag
aaagccatatccacttcaaatgcttataatgatcagttcaggacgcttgtggaatcagga
aaggacattgaaagcgcctactgggaactcgtggtgaaggatattcaggatgcgtgcaag
ctctttgagccaatctatgaccagacagaagctgaggatggctacgtctccgttgaagtc
tcgcctaggcttgctgatgataccaacggcactgttgaagctgctaaatatcttcacaag
gtggtggaccgtcgtaacgtctacattaagatccctgctactgctccatgcattccttcc
atcagagatgtcattgcttctggaataagcgtcaacgtcacgcttatattctcaatagct
agatatgaggcagtgatcgatgcatatttggatgggcttgaggcttctggacttgatgac
ctctctagagttacaagtgttgcatctttctttgtgagtcgggtggatactcttatggac
aagatgcttgagaagattggtaccccagaagccttagacctccgtggcaaggcagctgtg
gctcaagctgcattagcatacaagctgtaccagaagaaattctcaggaccaagatgggag
gctctggtgaagaaaggtgccaagaagcagaggcttctctgggcatcgactagtgttaag
aacccagcttactctgacaccttatatgtcgctcctctcattggacctgacactgtgtca
accatgccggatcaagcactggaagcattcatagatcatggaaccgtgaagaggactata
gatgcaaatgtgtcggaagcagaagggatttacagtgcactagagaagctgggaatagac
tggaacaaggtgggagaacagttggaagaagaaggtgttgactctttcaaaaagagtttt
gagagtcttcttggtacactacaagacaaggccaacactctcaaattagccagccattga

KEGG   Brassica napus (rape): 106372300Help
Entry
106372300         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106372300
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106372300
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106372300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106372300
NCBI-ProteinID: XP_013667934
UniProt: A0A078F9V9
AA seq 439 aa AA seqDB search
MASISNLANLAPATATNSRSSSTSSVLPRSFLNLRSLNAKLSSSSHLSLRHHQTSRPSLF
VRCSASGGNGSAAKRTTLHDLYDKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPAIFQ
KAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVSVEV
SPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIA
RYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAV
AQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVS
TMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFKKSF
ESLLGTLQDKANTLKLASH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttccaatctcgcaaatcttgcacccgccactgctaccaactccagatct
tcttctacttcctccgtcttaccaagatccttcctcaacctccgcagtttgaacgctaag
ctttcctcttcttctcatctctcccttcgtcaccaccaaacatccagaccttccctcttt
gtgaggtgttcagcctctggtggaaacggaagtgctgcaaagagaacgactcttcacgat
ctatacgacaaggaaggtcagagtccttggtatgacaatctttgccgtcccgtcactgat
ctcctccccttcattgcccgtggtgttcgtggcgttactagcaaccctgcgatcttccag
aaagccatatccacttcaaatgcttataatgatcagttcaggacgcttgtggaatcagga
aaggacattgaaagcgcctactgggaactcgtggtgaaggatattcaggatgcgtgcaag
ctctttgagccaatctatgaccagacagaagctgaggatggctacgtctccgttgaagtc
tcgcctaggcttgctgatgataccaacggcactgttgaagctgctaaatatcttcacaag
gttgtggaccgtcgtaacgtctacattaagatccctgctactgctccatgcattccttcc
atcagagatgtcattgcttctggaataagcgtcaacgtcacgcttatattctcaatagct
agatatgaggcagtgatcgatgcatatttggatgggcttgaggcttctggacttgatgac
ctctctagagttacaagtgttgcatctttctttgtgagtcgggtggatactcttatggac
aagatgcttgagaagattggtaccccagaagccttagacctccgtggcaaggcagctgtg
gctcaagctgcattagcatacaagctgtaccagaagaaattctcaggaccaagatgggag
gctctggtgaagaaaggtgccaagaagcagaggcttctctgggcatcgactagtgttaag
aacccagcttactctgacaccttatatgtcgctcctctcattggacctgacactgtgtca
accatgccggatcaagcactggaagcattcatagatcatggaaccgtgaagaggactata
gatgcaaatgtgtcggaagcagaagggatttacagtgcactagagaagctgggaatagac
tggaacaaggtgggagaacagttggaagaagaaggtgttgactctttcaaaaagagtttt
gagagtcttcttggtacactacaagacaaggccaacactctcaaattagccagccattga

KEGG   Brassica napus (rape): 106376238Help
Entry
106376238         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106376238
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106376238
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106376238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106376238
NCBI-ProteinID: XP_013671760
AA seq 410 aa AA seqDB search
MTHTLQSPPSAAALSASIQKGRWKTAAAGFSVAPPPPAVNFTLRRSIPRIHASASSSSSS
SSPSSPSLGAGENSELDAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTI
FRNAVDMALADSTCAGLDTTDSKLSCFFDKAIVNVGGDLVKLVPGRVSTEVDARLAYDTN
AIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAAKLLESEGIQTHLTFVYSFAQAAA
AAQAGASVIQIFVGRLRDWARNHSGDAEIETAVKSGEDPGLALVRRSYNYIHKYGYKSKL
MAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAVPDDEKYSFVRKLSPETATHYNFTN
KELIKWDQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIWPPPNV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacacacactctgcaatctccgccttctgcagcagctctctctgcttcgatccaaaag
ggacgatggaagacggccgccgccggattctccgttgctcctcctcctcccgccgttaac
ttcactctccggcgatcgattccacggattcacgcttccgctagctcctcctcctcctcc
tcctctccatcttctccatctctcggagctggtgagaacagtgagctagatgctgtatca
gcttttagtgagattgttcctgatactgtcgttttcgatgactttgagaggttcccgcca
actgcagctactgttagctctgctctcctccttggcatctgtggtctccccgacacaatc
ttccggaatgctgtggacatggctttggcggactctacctgtgcggggcttgataccact
gactccaaactctcttgctttttcgataaggctattgtgaatgtaggtggagatcttgtc
aaactcgttccaggtcgtgtttcaactgaagtggatgcacgtcttgcttatgacaccaac
gccattatccgtaaggttcatgatctgttaagactatacaatgagatcgacgtaccacac
gaccggttgctgttcaaaatccctgcaacctggcaaggtattgaagctgcaaagctgctg
gaatccgagggaattcaaacgcacttgaccttcgtttacagctttgctcaagcagcagca
gccgctcaagccggtgcctctgtcattcagattttcgtcggtcgcctcagggactgggcg
cgcaatcattcaggagatgccgagattgaaactgcggttaaatccggggaagatccaggt
ttggccttggtcagaagatcgtataactacattcacaagtatggttacaagtccaagcta
atggctgctgctgtcagaaacaaacaggacttgttcagtcttctcggggttgattatgtg
attgcgccattgaaggtattgcaatctctcaaagactcaccagccgttcctgacgatgag
aaatactcgttcgttcggaaactttctcctgagaccgcaacacactacaacttcaccaac
aaagagctgatcaagtgggaccagctaagcttggcttcagctatgggtcctgcatcagtg
gagcttttatcagctggtgtggaaggttatgcgaaccaagcgaaacgcgttgaagagctc
tttgggaagatttggccacctccaaatgtctaa

KEGG   Brassica napus (rape): 106384143Help
Entry
106384143         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106384143
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106384143
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106384143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106384143
NCBI-ProteinID: XP_013679610
AA seq 440 aa AA seqDB search
MASISNLANLTPATSAGSSRSSSSSSVLPRSFITLRTLNSKLSSSSHLSLRYNQTSTPSL
FVRCSASGENGSTTKKTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPAIF
QKAISTSNAYNDQFRSLVESGNDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVSVE
VSPMLADDTNGTVEAAKYLHKVVNRRNVYIKIPATAPCVPSIRDVIASGISVNVTLIFSI
ARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAA
VAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTV
STMPDQALEAFIDHGTVKRTIDENVSEAEGIYSALEKLGIEWNKVGEQLEEEGVDSFKKS
FESLLGTLQDKASTLKLASH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttccaatctcgctaatcttacacccgccacttctgccggcagctccaga
tcttcttcttcctcctccgtcttaccaagatccttcatcactcttcgcactctgaactcg
aagctttcctcttcttctcatctctcccttcgttacaaccaaacatcaacaccttccctc
tttgtgaggtgttcagcttctggtgagaatggaagtactacaaagaaaactactcttcat
gatctatatgagaaggaaggtcagagtccttggtatgataatctttgccgtccagtgact
gatcttctccccttcattgcccgtggcgttagaggcgtaaccagcaaccctgcgatcttc
cagaaagccatttccacttcaaatgcttacaatgaccagttcaggtcacttgtggaatca
ggaaatgacattgaaagcgcgtattgggaactcgtggtgaaggatattcaggatgcttgc
aagctttttgagccaatctatgaccagacagaagctgaggatggctatgtgtccgttgaa
gtctcacctatgcttgctgatgacaccaacggaaccgttgaagcagctaagtatcttcac
aaggttgtgaaccgtcgtaatgtctacatcaagatccctgctactgctccgtgcgtgcct
tctattagggatgtcattgcatcaggaataagtgtcaatgtcacgcttatattctcaata
gcaagatacgaggcagtgatagatgcatacttggatgggcttgaggcgtctggacttgat
gacctctcgagagttaccagtgttgcatccttttttgtgagtagggtggatactctcatg
gacaagatgcttgagaaaattggtacaccagaagctctagacctccgtggcaaggcagct
gtggctcaagctgcattagcatataagctttaccagaagaaattctcaggtccgagatgg
gaagctttggtgaagaaaggtgccaagaagcagaggcttctctgggcgtcgacaagtgtc
aagaacccagcttactcagataccctatatgtagctcctcttattggacctgacactgtg
tcaaccatgcctgatcaagccctggaagcattcatagaccatggaacagtgaagaggaca
atagatgagaatgtatcagaagcagaagggatatacagtgcactggagaagctgggaata
gagtggaacaaggtgggagagcagttggaagaagaaggtgtagattcgttcaagaagagt
ttcgagagtctgcttggtactctgcaagacaaggccagcactctcaaactagccagccac
tga

KEGG   Brassica napus (rape): 106401634Help
Entry
106401634         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106401634
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106401634
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106401634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106401634
NCBI-ProteinID: XP_013697629
AA seq 406 aa AA seqDB search
MTLSLQSPPSAAALSASIQKGRWKTVAVGFSVAPPPSVNFTLRRSIPRIHASASSSSSPS
SPSLGAGENNELDAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNA
VDMALADSTCAGLDTTESKLSCFFDKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNAIIR
KVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAAKLLESEGIQTHLTFVYSFAQAAAAAQA
GASVIQIFVGRLRDWARNHSGDTEIETAVKSGEDPGLALVRRSYNYIHKYGYKSKLMAAA
VRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAVPDDEKYSFVRKLTPETATHYNFTNKELI
KWDQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIWPPPNV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacactctctctgcaatctccgccttctgcagcagctctctctgcttcgatccaaaag
ggacgatggaagacggtcgccgtcggattctccgttgctcctcctccctccgttaacttc
actctccggcgatcgattccacggattcacgcttccgctagctcctcctcctctccatct
tctccatctctcggagctggtgagaacaatgagctagatgctgtatcagcttttagtgaa
attgttcctgatacagtcgttttcgatgactttgagaggttcccaccaactgcagctact
gttagctctgctctcctccttggcatctgcggtctccccgacacaatcttccggaatgct
gtggacatggctttggcggactctacctgtgcgggccttgataccactgagtccaaactc
tcttgctttttcgataaggctattgtgaatgtaggtggagatcttgtcaaactcgttcca
ggtcgtgtttcgactgaagtggatgcacgtcttgcttatgacaccaacgccattatccgc
aaggttcatgatctgttaagactctacaatgaaatcgatgtacctcacgaccggctgctt
ttcaaaatccctgcaacttggcaaggtattgaagctgcaaagctgctggaatccgaggga
attcaaacgcacttgaccttcgtttacagctttgctcaagcagcagcagccgcccaagca
ggtgcatctgtcattcagattttcgttggtcgcctcagggactgggcgcgtaatcattca
ggagatacggagattgaaactgcggttaaatccggggaagatcctggtttggccttggtc
agaagatcatataactacattcacaagtatggttacaagtccaagctaatggctgctgct
gtcagaaacaaacaagacttgttcagtcttctcggggttgattatgtgattgcgccattg
aaggtgctgcagtctctcaaagactcaccagccgttcctgacgatgaaaaatactcgttt
gttcggaaacttactcctgagaccgcgacacactacaacttcaccaacaaagagctgatc
aaatgggatcagctgagcttggcttcagctatgggtcctgcatccgtggagcttttatca
gctggtgtggaaggttacgcgaaccaggcgaaacgcgttgaagagctctttgggaagatt
tggccacctccaaacgtctaa

KEGG   Brassica napus (rape): 106431896Help
Entry
106431896         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106431896
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106431896
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106431896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106431896
NCBI-ProteinID: XP_013728187
AA seq 436 aa AA seqDB search
MASISNLTNLTPATSTCPRSSSVIPRSFVNIRSFNAKLSSASHLSIRYNKQTRPSLFVRC
SASGGNGSTAKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPFIARGVRGVTSNPAIFQKAI
STSDAYNDQFRTLVESGTAIKKAYWELVVKDIQDACKLFEPIYDQTDAEDGYVSVEVSPL
LADDTKTTVKAAKLLHKSVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIARYE
AVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAVAQA
ALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVSTMP
DQALEAFIDHGTVKRTIDANVSEAEGVYSALEKLGIDWNKVGEQLEEEGVDSFKKSFESL
LGTLQDKANSLKLASQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttccaatctcaccaaccttactcccgcaacttccacctgccccagatct
tcctctgtcataccaagatccttcgttaacatccgcagttttaacgccaagctttcttct
gcttcccatctttctattcgttacaacaaacagaccagaccttccctctttgtgaggtgt
tcagcctctggtggaaatggaagtactgcaaagagaaccactcttcacgatctatatgag
aaggaaggccagagtccttggtatgataatctatgccgtcctgtcactgatcttatcccc
ttcattgcccgtggcgttcgtggtgtaactagcaaccctgcgatcttccagaaagccata
tccacttcagatgcttataatgatcagttcaggacacttgtggagtctggaacggccatt
aaaaaagcgtactgggagcttgtggtgaaggatattcaagatgcttgcaagctttttgag
ccaatctatgaccagactgatgctgaggatggctatgtttctgttgaagtttcacctctg
cttgctgatgataccaaaaccactgttaaagctgctaaacttcttcacaagtctgtgaac
cgtcgtaatgtctatattaagatccctgctactgctccatgtattccttccatcagagat
gtcattgcttctggaataagtgtcaatgtcacgcttatattctcaatagctagatatgag
gcagtgatcgatgcatatttggatggactcgaggcgtctggacttgatgacctctcaaga
gttacaagtgttgcttccttctttgtgagtagggtggatactctcatggacaagatgctt
gagaagattggtaccccagaagctctagacctccgtggcaaggcggctgtggctcaagct
gcattagcataccaactataccagaaaaagttctcaggcccaagatgggaagctttggtg
aagaaaggtgccaagaagcagaggcttctctgggcatcgacaagtgtcaagaacccagct
tactctgacactttatatgttgctcctctcattggacctgacactgtgtcaaccatgccg
gatcaagcgctggaagcgttcattgaccatggaacggtgaagaggacgatagatgcgaat
gtgtcagaagcagaaggggtgtacagtgcactagagaagctgggaatagactggaacaaa
gtgggagaacagttggaagaagaaggtgtagactcgttcaagaagagtttcgagagtctg
cttggtacacttcaagacaaggccaactctctcaaactagccagccaatga

KEGG   Brassica napus (rape): 106431950Help
Entry
106431950         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106431950
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106431950
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     106431950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 106431950
NCBI-ProteinID: XP_013728252
AA seq 436 aa AA seqDB search
MASISNLTNLTPATSTCPRSSSVIPRSFVNIRSFNAKLSSASHLSIRYNKQTRPSLFVRC
SASGGNGSTAKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPFIARGVRGVTSNPAIFQKAI
STSDAYNDQFRTLVESGTAIKKAYWELVVKDIQDACKLFEPIYDQTDAEDGYVSVEVSPL
LADDTKTTVKAAKLLHKSVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIARYE
AVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAVAQA
ALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVSTMP
DQALEAFIDHGTVKRTIDANVSEAEGVYSALEKLGIDWNKVGEQLEEEGVDSFKKSFESL
LGTLQDKANSLKLASQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttccaatctcaccaaccttactcccgcaacttccacctgccccagatct
tcctctgtcataccaagatccttcgttaacatccgcagttttaacgccaagctttcttct
gcttcccatctttctattcgttacaacaaacagaccagaccttccctctttgtgaggtgt
tcagcctctggtggaaatggaagtactgcaaagagaaccactcttcacgatctatatgag
aaggaaggccagagtccttggtatgataatctatgccgtcctgtcactgatcttatcccc
ttcattgcccgtggcgttcgtggtgtaactagcaaccctgcgatcttccagaaagccata
tccacttcagatgcttataatgatcagttcaggacacttgtggagtctggaacggccatt
aaaaaagcgtactgggagcttgtggtgaaggatattcaagatgcttgcaagctttttgag
ccaatctatgaccagactgatgctgaggatggctatgtttctgttgaagtttcacctctg
cttgctgatgataccaaaaccactgttaaagctgctaaacttcttcacaagtctgtgaac
cgtcgtaatgtctatattaagatccctgctactgctccatgtattccttccatcagagat
gtcattgcttctggaataagtgtcaatgtcacgcttatattctcaatagctagatatgag
gcagtgatcgatgcatatttggatggactcgaggcgtctggacttgatgacctctcaaga
gttacaagtgttgcttccttctttgtgagtagggtggatactctcatggacaagatgctt
gagaagattggtaccccagaagctctagacctccgtggcaaggcggctgtggctcaagct
gcattagcataccaactataccagaaaaagttctcaggcccaagatgggaagctttggtg
aagaaaggtgccaagaagcagaggcttctctgggcatcgacaagtgtcaagaacccagct
tactctgacactttatatgttgctcctctcattggacctgacactgtgtcaaccatgccg
gatcaagcgctggaagcgttcattgaccatggaacggtgaagaggacgatagatgcgaat
gtgtcagaagcagaaggggtgtacagtgcactagagaagctgggaatagactggaacaaa
gtgggagaacagttggaagaagaaggtgtagactcgttcaagaagagtttcgagagtctg
cttggtacacttcaagacaaggccaactctctcaaactagccagccaatga

KEGG   Brassica napus (rape): 111201488Help
Entry
111201488         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC111201488
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111201488
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     111201488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 111201488
NCBI-ProteinID: XP_022549286
AA seq 439 aa AA seqDB search
MASISNLANLTPATSTNSRSSSSSSVLPRSFLNLRSLNAKLSSSSHLSLRHHQTSRPSLF
VRCSASGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPAIFQ
KAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVSVEV
SPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIA
RYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAV
AQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVS
TMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFKKSF
ESLLGTLQEKANTLKLASH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatttcaaatctcgcaaatcttacacccgccacttccaccaactccagatct
tcttcttcctcctccgtgttaccgagatccttcctcaacctccgcagtttgaacgctaag
ctttcctcttcttctcatctctcccttcgtcaccaccaaacttccagaccttccctcttt
gtgaggtgttcagcctctggtggaaacggaagtgctgcaaagagaaccactcttcacgat
ctatacgagaaggaaggccagagtccttggtatgataatctttgccgtcccgtcactgat
cttctccccttcattgctcgtggtgttcgtggcgttactagcaaccctgcgatcttccag
aaagccatatccacttcaaatgcttataatgatcagttcaggacacttgtggaatcagga
aaggacattgagagtgcgtattgggagcttgtggtgaaggatattcaggatgcttgcaag
ctctttgagccaatctatgaccagacagaagctgaggatggctacgtctccgttgaagtc
tcacctaggcttgctgatgataccaacggcactgttgaagctgctaaatatcttcacaag
gttgtggaccgtcgtaacgtctacattaagatccctgctactgctccatgcattccttcc
atcagggatgtcattgcttctggaataagtgtcaatgtcacgcttatattctcaatagct
agatacgaggcagtgatcgatgcatatttggatgggctcgaggcatcaggacttgatgac
ctctctagagttaccagtgttgcatccttctttgtgagtcgagtggatactcttatggac
aagatgcttgagaagattggtaccccagaagccttagacctccgtggcaaggcagctgtg
gctcaagctgcattagcatacaagctgtaccagaagaagttctcaggaccaagatgggag
gctctagtgaagaaaggtgccaagaagcagaggcttctctgggcatcgactagtgttaag
aacccagcttactctgacaccttatatgttgctcctctcattggacctgacactgtgtca
accatgccggatcaagccttggaagcattcatagaccatggaaccgtaaagaggacgata
gatgcgaatgtgtcagaagcggaagggatatacagtgcactagagaagctgggaatagac
tggaacaaggtgggagaacagttggaagaagaaggtgttgactctttcaaaaagagtttt
gagagtctgcttggtacactacaagagaaggccaacactctcaaattagccagccattga

KEGG   Brassica napus (rape): 111204272Help
Entry
111204272         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC111204272
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111204272
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     111204272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 111204272
NCBI-ProteinID: XP_022554336
AA seq 437 aa AA seqDB search
MASVTNLTNLTPATTSAGSRSSSVLPRSSVNLRSFNAKLSSASHLSLRYNPQYRPSLFVR
CSASGGNGSTAKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPFIARGVRGVTSNPAIFQKA
ISTSDAYNDQFRTLVESGTAIKKAYWELVVKDIQDACKLFEPIYDQTEAEDGYVSVEVSP
LLADDTKTTIKAAKLLHKSVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSIARY
EAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKAAVAQ
AALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVSTM
PDQALEAFIDHGTVKRTIDANVSEAEGVYSAIEKLGIDWNKVGEQLEEEGVDSFKKSFES
LLATLQDKANTLKLASH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgttaccaatctcaccaaccttacacccgccaccacttctgccggctctaga
tcttcctccgtcttaccaagatcctccgtcaacctccgaagttttaacgccaagctttct
tctgcttcccatctttcccttcgttataacccacaatacagaccttccctttttgtgagg
tgttcagcctctggtggaaacggaagtactgctaagagaactactcttcacgatctatat
gaaaaggaaggccagagtccttggtatgataatctatgccgtcctgtcactgatcttatc
ccctttattgcccgtggcgttcgaggtgtaactagcaaccctgcgatcttccagaaagcc
atatccacttcagatgcttataatgatcagttcaggacacttgtggagtctggaacggcc
attaaaaaagcgtactgggagcttgtggtgaaggatattcaggatgcttgcaagcttttc
gagccaatctatgaccagactgaagctgaggatggctacgtctcggttgaagtttcgcct
cttcttgctgatgataccaaaaccactattaaagctgctaaacttcttcacaagtctgtg
aaccgtcgtaatgtttatattaagatccctgctactgctccatgtattccttccatcaga
gatgtcattgcttctggaataagtgtcaatgtcacgcttatattctcaatagctagatat
gaggcagtgattgatgcttatttggatggacttgaggcgtctggacttgatgacctctca
agagttacaagtgttgcttccttctttgttagtcgtgtggatacactcatggacaagatg
ctggagaagattggtacaccagaagcactagacctccgcggcaaggcggctgtggctcaa
gctgcattagcatatcaactataccagaaaaagttctcaggcccaagatgggaagctttg
gtgaagaaaggtgccaagaagcagaggcttctctgggcatcgacaagtgttaagaaccca
gcttactctgacaccttatatgtcgctcctctcattggacctgacactgtgtcaacgatg
cctgatcaagcccttgaagcattcattgatcatggaacggtgaagaggacgatagatgcg
aatgtgtcagaagcagaaggggtttacagtgcaatagagaagctgggaatagactggaac
aaggtgggagaacagttggaagaagaaggtgtagactcgttcaagaagagtttcgagagt
ctgcttgctacacttcaagacaaggccaacactctcaaactagccagccactga

DBGET integrated database retrieval system