KEGG   Brassica napus (rape): 106372475Help
Entry
106372475         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106372475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106372475
Enzymes [BR:bna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106372475
Spliceosome [BR:bna03041]
 Complex C
  Other components
   Step II factors
    106372475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-C3HC4_2 zf-RING_UBOX zf-C3HC4 zf-RING_2 AAA_22 Helicase_RecD zf-RING_5 zf-C3HC4_3 AAA_30 ABC_tran KH_1 AAA_29 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 106372475
NCBI-ProteinID: XP_013668150
AA seq 1767 aa AA seqDB search
MRSSLPPPNSGRSTTTNRQLSLPSASTNRSNSRSSHSSPPLTHRPTQNHPHRNHHYPNSN
FPPNHRPDRGPTTRSRPNFIVQLVHPRTTTAANTDANPSFSVRKQAIITLASLCGIPEDS
IHVPQLGSVAGTFNFRQWTDALSAVVSLWDRRLRGKHDFVPELVPNVIVPSDVDELRDRL
RDLFSSHVLSLVENGEGVKKVRREIDEKSRRAESFDSKRGLRLEVFEMKKALEAERDLVI
KRLEEFKNAMMSIVRFLKRSDDGVEVDDVDVFSLEGDYDWPRVHSLIRRECRRLDDGLPI
YAYRQNILKKVYGQQVTVLIGETGSGKSTQLVQFLADSGIAASESIVCTQPRKIAALTLA
DRVREESNGCYEEEDSVSCTPAYSSAEKFSAKVVFMTDNCLLQHYIRDNSLSGVSCVIID
EAHERSLNTDLVLALLKDLMCRRVDLRLVIMSATADAYQLSGYFFGCEILRVAGRNFPVE
IIYSPSGDTEGTSYADDVVKKAMEVHRTEKEGTILAFLTSQAEVEWACERFIAPSAVALP
LHGKLSFEEQFRVFQNYPGRRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEARTGMS
ILKVCRVSKSSAQQRAGRAGRTEAGRCYRLYSKYEFTSMSLNQEPEIRRVPLGVAILRIL
ALGVDNLADFDFIDAPDPEAVVMAVKNLVQLGAVVERNGVLELTQEGHCLVKLGLEPKLG
KLILGCFRHRMGKEGIVLAAVMANASSIFCRVGNFDDKMKADCLKVKFCNHDGDLFTLLS
VYKEWASLPRERRNKWCWENSLNAKSMRRCEDTVKELEICIERELSLDSPSYWVWNPAEG
NNKHEKHMKMVILASLAENVAMYTGYDQLGYEVALTGQQVQLHPSCSLLAFGQKPNWVVF
GELLSVVDQYLVCVTAFDFEALSTLDPPPPFDASHMDEWRVRVKKVAGCSSTMLKRFCGK
SNRGLLSIVSRARSLCEDERINIQVNVEQNEILMYAPPHDMDKVSALVNDALECEKKLMR
NECLEKYIYHGGGQVPLALFGSGAQIKHLEVDQRFLTVDVLYYGDNSLDDREVLTFLEKE
IDGCICSIHKYAGKKQDCDEKEKWGRVTFLTPESAMKATETQKFDLNGSVIKLFPSLSAG
GEGVFKMPSVTAIIRWPRRESCGKGVLKCASGDIHRIFAGSSGIMIGTKYCPFETDQKHT
DSILITGIDTNLSDAEVLDVLEFATERTDLEFFLFRGGNIAYRPSLTDCKYMLHKRIFAR
LSSRNPDPNCVEVKVYVPKEKDHFVRALITFDGRLHLEAAKALQELDGTILDGCYPWQKI
KCEQKFQSSIICPAFIYNIVRRQLYAKLASFERQRECEWHLEAIHSGAYRVKISANATRR
ISEMRRSLEELIRGRPIINHPSLTQRVLQHLLSREGVILMRKIQQETETCIVVDRHSLAV
RICGSEERIAAAEQELVRSLLSYHESKQLEIRLRGPNLRPDLMKEVVNRFGPELQGIKEK
VKGVDLKLNTRYHVIHVHGSVEMRQEVEKMVYELTQEEGCAPDDVEVECPICLSEVEDGY
SLEGCSHLFCKACLLEQLEASMRNFDAFPIICSHIDCGAPIVVADMRALLSQEKLDELFR
ASLSSFVTTSDGKFRFCSTPDCPSIYRVAGPLDSGVPFFCGACNSKTCTRCHLEYHRYIT
CERYKLFKEDPDMSLKDWAKGKNVKECPCCKSTIEKSEGCNHLLCRCGNHICWVCLRWFA
QQEPCYEHLRAVHGGIGLFDELGMAML
NT seq 5304 nt NT seq  +upstreamnt  +downstreamnt
atgaggagttcacttcctccgcccaacagtggacgatcgaccacaactaatcgtcaattg
tctcttccctccgcttccaccaaccgttccaactctcgctcttctcactcttctccgccg
ctcactcaccgacccactcaaaaccacccccaccgcaaccaccactaccctaactccaat
ttcccgccaaatcacaggcccgatcggggcccaacaactcgttccaggcccaatttcatc
gtccagctcgttcacccaagaaccaccaccgccgctaacaccgacgccaatccctctttc
tcggttagaaagcaagcgatcatcaccctcgcttctctctgcggaatcccggaggactcc
atccacgtcccccagctcggctccgtcgccggaactttcaattttcgccaatggaccgac
gcgctctccgccgtcgtgtctctctgggaccgtcgcctccgagggaagcacgatttcgtc
cccgagctggttcccaacgtcatcgtcccttccgacgtggacgagcttagagacaggctc
cgcgatctcttctcgtctcacgttctctcccttgtggaaaacggagaaggcgtgaagaag
gtgagacgagagattgatgagaagtctcgtcgagctgagtcgtttgattccaaaaggggt
cttaggttagaggtgtttgagatgaagaaggctttggaggcggagagggatttggttatt
aagcggcttgaagaattcaagaacgctatgatgagcattgtgcggtttctcaaaagaagt
gatgatggagtcgaagttgatgacgtggacgtgtttagtttggaaggggactatgattgg
ccacgtgttcatagtttaatccgcagggagtgtcgaaggcttgatgatgggctgcctata
tatgcttaccggcaaaatattttgaagaaagtttatggccaacaggtaaccgtattgatt
ggagaaactggttcagggaagagcactcagttagttcagttccttgctgactccggcatt
gccgctagtgaatcgattgtttgtacacagccaaggaagatcgctgcattgacattggct
gatcgggtcagagaagaaagcaatggttgttatgaggaggaagattccgtcagctgcact
ccagcttactcttcggcggagaagtttagtgccaaagttgtgttcatgacggataactgt
ctgcttcaacactacattagagataatagtttgtctggagtttcgtgcgttattattgac
gaagcacatgaaagaagcttaaacacggacctggttttggcgttgctcaaagatctgatg
tgcagaagagttgacttgaggcttgtcatcatgtccgccacggcagatgcttaccagctt
tcggggtatttctttggctgtgagattctccgcgtcgccggaaggaactttccggtggag
attatatattcacctagtggtgacacagaagggacttcatatgctgatgatgttgttaag
aaggcgatggaagtgcatagaacagagaaagaaggaaccatcctcgccttcttgacttcc
caagcagaggtagagtgggcttgcgaaaggtttatagctccatctgcagtcgctttgcct
ttgcatggaaagctatctttcgaagaacagtttagggttttccagaactatcctgggaga
aggaaagtgatattcgccacaaatattgcggagacctctctgactattcccggcgtcaag
tatgtaattgattccgggatggtgaaagagagtaaatacgaggctagaacgggtatgagc
atcctcaaggtttgcagagtcagtaaaagttcagctcagcaacgcgctggtcgtgctggg
aggacggaagctggaagatgttacagactctactcaaaatacgagtttacttccatgagt
cttaatcaggagcctgagattcggagggttcctctcggtgtagcgattttgaggattctt
gcgctgggtgtagacaacctagcggattttgattttatcgacgcgcctgaccctgaagcc
gtcgtgatggctgtcaaaaatcttgttcagttgggtgcagtcgttgagaggaatggtgtt
cttgagttaacgcaggaaggacattgtttagttaagctgggtctggagccaaagcttggt
aagttgattttggggtgcttcagacacagaatgggcaaagaggggattgttctcgctgct
gtcatggccaatgctagtagtatattttgcagagttggcaacttcgatgataagatgaaa
gctgactgcctaaaggtgaaattctgcaaccatgatggagacctgttcactcttctttcg
gtgtacaaagaatgggcatctctgccgcgagagagaagaaacaaatggtgctgggaaaat
agcctgaacgccaaatcaatgaggagatgcgaagacacagtcaaggagctggagatatgc
attgaaagagaactttctcttgacagtccaagctactgggtttggaacccagcagagggt
aataataaacacgagaagcatatgaaaatggttatacttgcatctcttgctgaaaacgtg
gcgatgtacactggctatgaccagctcgggtatgaggtggcattgactgggcaacaagtt
cagttgcatccgtcgtgttcgttgctagcgtttggacagaagccaaactgggttgttttc
ggcgagcttctgtcagttgtcgaccagtacttggtatgtgtgaccgcatttgatttcgag
gctttgtctacgcttgatccacctccaccttttgatgcgtctcatatggatgagtggagg
gtccgagtgaaaaaggtggctggttgtagcagcactatgctaaaacgattctgtgggaaa
tctaaccgtggtctgctttcgattgtctctcgtgctaggtctctttgtgaggatgagagg
attaatattcaagttaatgtcgaacagaacgagattctaatgtacgcgcctccccacgac
atggacaaagtctcggcactagtgaacgatgcattggaatgtgaaaagaagttgatgcgt
aatgaatgtttggagaagtatatatatcatggaggaggacaggtgccccttgcgctgttc
ggatctggtgctcagataaagcatcttgaagttgatcagagattcttgacagtcgatgta
ctctattacggcgacaactctcttgatgacagagaggttctgacgttcctggagaaggag
atcgatggatgtatctgctctattcataagtatgctggtaagaagcaagactgtgatgag
aaagagaagtggggtagggttacctttctgactccggaatctgctatgaaggcaacagaa
actcagaagtttgatctcaatggatcagtgattaaactatttccatcgctatcagctggt
ggtgaaggagttttcaagatgccttctgttacagctatcattcgttggcctcgaagggaa
agttgtggtaaaggtgttcttaagtgtgcttctggtgatattcacagaatctttgctggg
tcatccggcatcatgataggaacaaaatattgcccctttgagacggatcaaaaacacact
gattctatcttgattactggtattgacacaaatctttcggatgctgaagttttagatgtt
ttggagttcgctacggagaggacagatttagaatttttcttattcagaggaggaaatatt
gcgtatcgtccatctcttactgattgtaaatatatgctgcataagagaatatttgcgcgc
ttgtcatcgaggaatccagacccaaactgtgtcgaagtcaaagtttatgtaccaaaagaa
aaggatcattttgtgcgagcgttgattacttttgatgggagattacatctggaagctgcg
aaagctttgcaggagttagatggaactatcctagatggatgctatccatggcagaagata
aaatgcgagcaaaagtttcagagctccataatctgtcctgcttttatctacaacatagtc
agaagacaattatatgctaagctagcaagcttcgagagacaaagagaatgtgaatggcat
ctggaggcaattcatagtggtgcttatcgtgttaaaatctccgcaaatgcaacaagacgc
atctcggagatgcggagatctctcgaagaactcataagaggaagacccataataaaccat
ccaagcttaacccaaagggtcttgcagcatcttttgtccagagaaggtgttatcctgatg
cgaaagatccaacaggagactgaaacttgcattgtggtagacaggcacagtctcgcagta
cgcatttgtggatcagaagagagaattgctgcggctgaacaagagctggttcggtcgctt
ctgtcttatcacgagagcaagcagcttgaaatccgcctccgaggtccgaatctccgtcct
gacctcatgaaggaagttgtgaatcggtttggtccagagctccaaggtattaaagaaaag
gtaaaaggtgtggatctcaagctcaacactcggtaccatgttattcatgttcatgggagc
gtggagatgaggcaggaagtagagaagatggtctatgaacttacacaggaagaaggttgt
gcaccagatgacgttgaagttgaatgccccatttgcttatctgaggttgaggatggctac
tctctcgaaggatgttcacacctcttctgcaaagcttgtttgttggaacagctcgaggcg
tcgatgagaaacttcgacgcatttcccataatctgttctcacatagactgtggagctccg
atagtagtggccgatatgagagccctcttatcacaagagaagctcgacgaactcttcaga
gcatccctctcctctttcgtaacaaccagcgatgggaagttcaggttctgctccacaccc
gattgcccttccatctaccgcgtagccggtcctctagattcaggggtgccatttttctgc
ggagcgtgtaactcaaagacatgcacgaggtgccacctggagtatcaccggtatatcact
tgcgaaaggtacaaactgttcaaggaggatccggacatgtcgttgaaggactgggcgaaa
gggaagaacgtgaaggagtgtccgtgttgcaagtccaccatagagaaatctgaagggtgt
aaccatctgctgtgccggtgtgggaaccacatttgctgggtctgcttaaggtggttcgct
caacaagaaccttgttatgaacatttgagagcagtccatggtgggataggcctcttcgat
gagctagggatggccatgctttga

DBGET integrated database retrieval system