KEGG   Brassica napus (rape): 106372530Help
Entry
106372530         CDS       T04128                                 

Definition
(RefSeq) aspartate--tRNA ligase 1, cytoplasmic-like
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bna  Brassica napus (rape)
Pathway
bna00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106372530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106372530
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bna03016]
    106372530
Enzymes [BR:bna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     106372530
Amino acid related enzymes [BR:bna01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   106372530
Transfer RNA biogenesis [BR:bna03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106372530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 106372530
NCBI-ProteinID: XP_022546424
AA seq 76 aa AA seqDB search
MSGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYGAPPHGGFGAGLERVVMLLCALNN
IRKTSLFPRDPKRLAP
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagctcaacgtatccatgacccagaactcttggagaagcgtgcaagagaatgc
ggcattgatgtcaagacaatatccacatacatcgatgcattcaggtatggtgcaccgcct
catggtggatttggagcggggctggagcgtgtggtaatgctcttatgtgccctcaataac
atccgcaaaacttctctattccctcgtgacccaaaaaggcttgctccctaa

DBGET integrated database retrieval system