KEGG   Brassica napus (rape): 106374342Help
Entry
106374342         CDS       T04128                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
bna  Brassica napus (rape)
Pathway
bna00906  Carotenoid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    106374342
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     106374342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 106374342
NCBI-ProteinID: XP_013669847
AA seq 581 aa AA seqDB search
MVSLLTMSTSGAITYPQAQSDLCMRPIKRQPKVKCTVHIDVTEQPLKLSSFTPRTTATPP
PQHNSLRLNIFQKAAAIAIDAAERALISHEKDTPLSKTADPSVQIAGNYFPVSEYPVRQF
LTVEGTIPDSIDGVYVRNGANPMFDPIAGHHLFDGDGMVHAIKITNGSASYACRFTKTER
LIQEKRLGRPVFPKAIGELHGHSGIARLMLFYARGLCGLVNNQNGVGVANAGLVYFNNRL
LAMSEDDLPYQLKITQTGDLETVGRYDFDGQLKSTMIAHPKLDPVTKELHALSYDVVRKP
YLKYFRFSPDGVKSPELEIPLETPTMIHDFAITENFVVIPDQQVVFKLGEMMAGNSPVVF
DGDKVSRLGIMPKDATEASEIIWVDSPETFCFHLWNAWESPETEEVLVIGSCMSPADSIF
NERDESLKSVLTEIRINLRTRESTRRAMMVDDVNLEIGMVNRNRLGRKTRFAFLAIADPW
PKVSGFAKVDLVTGEIEKYVYGDEKYGGEPFFLPSGSVDGGENEDDGYIFCHVHDEEIET
SELQIINAVNLKLEATIKLPSRVPYGFHGTFVDASELVDQV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggtttctctgcttacaatgtcgacgagcggtgctataacatatcctcaagcccaaagt
gatttatgcatgaggcccatcaaaagacagccgaaagttaaatgcacggtgcacatcgac
gtaacggagcaacccctaaaactttcttcatttacacccagaaccactgcgacgccgccg
ccgcagcataattccctccgactaaacatcttccagaaagcggcggcgattgctatcgac
gcggctgagcgcgcgttaatttcccacgagaaagatactcctctttccaaaaccgctgat
ccaagtgttcagatcgccggtaattattttccggtatcggaatatcccgtccgacaattt
cttaccgtcgaaggaacaatccctgacagcattgacggagtttacgtccgtaacggcgca
aatccaatgttcgacccgatcgctggacaccatttattcgacggagacggaatggttcac
gccattaaaataaccaacggttcagcaagctacgcatgccggtttactaaaaccgagaga
ttgattcaggaaaaacgattgggtagaccggttttcccgaaagcaatcggcgagcttcac
ggccactcgggaatcgcacgtctgatgcttttctacgcacgtgggctttgcggtctcgtc
aacaaccaaaacggcgtcggtgtagcgaacgccggtttggtttacttcaataaccggctg
ttagcaatgtcagaagacgatttgccgtatcagctgaaaataactcaaaccggggatctc
gaaaccgttgggcgttacgatttcgacggtcagttaaaatccacgatgatcgcccacccg
aaactcgacccggttacgaaggagctccatgcgctaagctacgacgtcgtgagaaagcct
tacttgaagtacttcaggttctcgccggacggcgttaaatcaccggaactagagatcccg
ctcgagactccgacgatgattcacgatttcgctataacggagaacttcgtggtgattccg
gatcaacaagtcgtgttcaagctaggggagatgatggccggaaactcgccggtggttttc
gacggcgataaggtttcgcgattggggataatgccgaaagacgcgacggaggcttccgag
ataatctgggtggattcgccggagacgttctgtttccatctctggaacgcgtgggaatcg
ccggagactgaggaagtgttggtgatcgggtcgtgtatgtcgccggcggattctatcttc
aacgagagagacgagagcttgaaaagcgtcttgacggagatcaggataaacctcaggacg
cgtgaatccacgcgccgagcgatgatggtcgacgatgtgaatttagagatcggtatggtt
aaccgaaaccggttaggtaggaaaaccaggttcgcgtttctggctatcgctgatccttgg
ccgaaagtatccggtttcgctaaggttgatcttgtcaccggcgaaattgaaaagtacgtt
tacggcgatgagaagtacggcggagaaccatttttcttgcctagtggctccgttgacggt
ggagaaaatgaagatgacggttatatattctgtcacgttcacgacgaagagatagagacg
tcggaacttcagattattaacgccgttaatttaaagcttgaagctacgattaaactaccg
tctagagtaccgtacggttttcatggtacgtttgtggatgcaagcgaactcgtggaccaa
gtataa

DBGET integrated database retrieval system