KEGG   Brassica napus (rape): 106376429Help
Entry
106376429         CDS       T04128                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase, mitochondrial-like isoform X1
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00062  Fatty acid elongation
bna01100  Metabolic pathways
bna01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106376429
   00062 Fatty acid elongation
    106376429
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     106376429
    1.3.1.-  
     106376429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 106376429
NCBI-ProteinID: XP_013671965
AA seq 377 aa AA seqDB search
MTALMKSVGVRAMKLLSSAVNFRLNQCGETPIRSLRSFSTLRSPPSKAIVYEQHGSPDSV
TRLVNLPPVEVRDNDVCVKLIAAPINPSDINRIEGVYPVRPPVPAIGGYEGVGEVYAVGS
KVNALSPGDWVIPSPPSSGTWQTFVVKEESVWHKIDKSCPMEYAATITVNPLTALRMLED
FVSLASAGDSLVQNGATSIVGQCVIQLARLRGISTINIIRDRAGSDEARENLKALGADQV
FSESQLNVKNVKSLLGELPEPALGFNCVGGNAASLVLKFLREGGTIVTYGGMSKKPITVS
TTSFIFKDLELKGFWLQNWLSLGKVRECREMIDYLLGLARDGKLKYETELVPFDEFPVAL
DKALGKVGRQPKQVITF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgttgatgaagtcggtcggtgtccgagctatgaaattgttgtcgtcggcggtg
aatttcaggttgaaccaatgcggcgaaacaccaatacgttctttgagatccttctcgacg
cttaggtcgccaccgtcaaaggccatcgtgtacgagcagcatggctctcccgattctgtc
accagattggtgaatctcccgccggtggaagtgagagacaacgatgtatgcgtcaaactg
atcgccgcgccgatcaatccctccgatatcaaccgaattgaaggtgtgtacccggttagg
ccacctgtaccagcgattggtggttatgaaggtgttggtgaagtctatgcagttggctcc
aaggtcaatgctctttctcctggcgattgggttattccatctccaccttcgtcagggact
tggcagacgtttgttgtcaaggaggagagtgtgtggcacaaaatcgacaaatcttgtcca
atggagtacgcggctaccattactgttaatcctttgacggctttaagaatgcttgaagat
tttgtgtccctagcttccgcaggagattctttggtacagaatggtgcaacaagtatcgtg
ggtcaatgtgtaatccagttagctaggctccgtggcatcagtaccatcaatatcatccgt
gatagagccgggtcggatgaagcaagagaaaatctgaaagctctaggtgcagaccaagta
ttttcagagagtcagctgaatgttaagaacgtgaaaagtcttttgggggagttacctgaa
ccagctctgggattcaactgtgttggtggcaatgctgcctctctcgtgctcaagtttctg
agggaaggaggaaccattgtaacatatggtgggatgtctaagaagccaatcactgtttca
acaacatctttcatctttaaggatttggagttgaaagggttttggctacagaactggttg
agtttgggtaaagtgagagaatgcagggagatgatagactatctcctcgggcttgcgcgg
gacggaaagctaaaatacgaaacggaactggttcctttcgacgagttccctgttgctctc
gataaagcgctggggaaggtaggtaggcaacccaaacaagtaatcacattctga

KEGG   Brassica napus (rape): 106402450Help
Entry
106402450         CDS       T04128                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase, mitochondrial
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00062  Fatty acid elongation
bna01100  Metabolic pathways
bna01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106402450
   00062 Fatty acid elongation
    106402450
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     106402450
    1.3.1.-  
     106402450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 106402450
NCBI-ProteinID: XP_013698641
AA seq 376 aa AA seqDB search
MTALMKSVGVQALKLLSSAVNFRMNQCGETPIGCLRSFSTVMSPPSKAIVYEQHGSPDSV
TRLVNLPPVEVRDNDVCVKMIAAPINPSDINRIEGVYPVRPPVPAIGGYEGVGEVYAAGS
KVNALSPGDWVIPSPPSSGTWQSFVVKEESVWHKIDKSCPMEYAATITVNPLTALRMLED
FVSLASGDSLVQNGATSIVGQCVIQLARLRGISTINIIRDRAGSDEARENLKALGADQVF
SESQLNVKNVKSLLGELPEPALGFNCVGGNAASLVLKFLREGGTMVTYGGMSKKPITVST
TSFIFKDLELRGFWLQNWLSLGKVKECREMIDYLLGLARDGKLKYETELVPFDEFPVALD
KALGKVGRQPKQVITF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgttgatgaagtcggtcggtgtccaagctctgaaattgttgtcgtcggcggtg
aatttcaggatgaaccaatgcggcgaaacaccaataggttgtttgagatccttctcgacg
gttatgtcgccaccgtcaaaggccatcgtgtacgagcagcatggctctcccgattctgtc
accagattggtgaatctcccgccggtggaagtgagagacaacgatgtatgcgttaaaatg
atcgccgcgccgatcaatccctccgatatcaaccgaatcgaaggtgtgtacccggttagg
ccaccggtaccagcgattggtggttatgaaggtgttggtgaagtctatgcagctggctcc
aaggtcaatgctctttctcctggcgattgggttattccatctccaccttcctcagggact
tggcagtcgttcgttgtcaaggaggagagtgtgtggcacaaaatcgacaaatcttgtcca
atggagtacgcggctaccattactgttaatcctttgacggctttaagaatgcttgaagat
tttgtgtccttagcttccggcgattctttggtacagaatggtgcaacaagtatcgtgggt
caatgtgtaatccagttagctaggctccgtggcatcagtaccatcaatatcatccgtgat
agagccgggtcggatgaagcaagagagaatctgaaagctctaggtgcagaccaagtattt
tcagagagtcagctgaatgttaagaacgtgaaaagtcttttgggggagttacctgaacca
gctctgggattcaactgtgttggtggcaatgctgcctctctcgtgctcaagtttctgagg
gaaggaggaaccatggtaacatatggtgggatgtctaagaagccaatcactgtttcaaca
acatctttcatctttaaggatttggagctgagagggttttggctgcagaactggttgagt
ttgggtaaagtgaaagaatgcagggagatgatagactatctcctcgggcttgcgcgggac
ggaaagctaaaatacgaaacggaactggttcctttcgacgagttccctgttgctctcgat
aaagcgcttgggaaggtaggtaggcaacccaaacaagtaatcacattctga

DBGET integrated database retrieval system