KEGG   Brassica napus (rape): 106376658Help
Entry
106376658         CDS       T04128                                 

Definition
(RefSeq) D-glycerate 3-kinase, chloroplastic-like isoform X2
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00561  Glycerolipid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106376658
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106376658
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106376658
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     106376658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRK SRP54 AAA_15
Motif
Other DBs
NCBI-GeneID: 106376658
NCBI-ProteinID: XP_013672214
AA seq 458 aa AA seqDB search
MAGATSSLILSPWQATLDHYNNKTKRFFVKGYPFPCHHSEPICNSFIIKRRVLSASSSSI
FKDNHVVTHSSSSSDKLQTHFSMSGCGCSWIQDNSMLHYSATSNWTSKKCSALPTTKTVD
VSSVSDLFEFICSGPLVDKIGITPEKVGQAIDKWLLYGSQLCRLFQLNELKLTIPQKARL
YHYYIPVFVWCQDQISLHSSKFNDGDDVPPLVIGFSAPQGCGKTTLVFALDYLFKTTKKK
SATISIDDFYLTAQGQAQLREDNPGNALLEYRGNAGSHDLPFSVETIEALSQLTKDDMKM
KVPRYDKSAYSGRGDRADAETWPEVEGPLKVILFEGWMLGFKPLPSEVVKSVDPQLETVN
KNLEAYYDAWDKYINAWVIIKIKDPSYVYRWRLQAEIAMRQAGKAGMSDDEVNDFVSRYL
PAYKAYLPTLYAEGPTGSDPDRVLAIDIDEERNPILAT
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcaacttcaagtttgatattgtctccatggcaagcgactcttgatcattat
aataataagactaagaggttttttgtcaaaggttatccgtttccgtgtcaccactctgaa
cctatttgcaattcttttattatcaaaagacgtgttctctctgcttcttcctcttccata
tttaaggacaaccatgtcgttactcattcttcatcctcctcagacaagcttcaaactcat
ttctccatgtctggttgtggttgctcgtggattcaagacaactcaatgcttcattattca
gctacaagtaattggacgtcgaagaaatgttcggcgttaccaacaacaaaaacagtggat
gtgtcctcagtttcagacctttttgagttcatatgctctggtccactcgtggacaagatc
ggtatcactcctgaaaaagttgggcaggccattgacaaatggttgctatatgggtcacag
ctatgcagactctttcagctgaatgagcttaagctcaccattcctcagaaagctaggctt
taccattactatatacccgtctttgtttggtgccaagaccagatttctctgcatagctcc
aagtttaatgatggagatgatgtgcctcccctagtgattggattcagcgcaccacaagga
tgtggcaagactacacttgtgtttgcacttgattatcttttcaaaactacaaaaaagaag
tcggcgacaatatctatagacgatttttacttgactgcacaaggccaggctcagttgaga
gaagataatccaggaaatgcacttctagagtatcgtgggaatgcaggaagccatgatctt
ccattctctgtcgaaacaatagaagccctgtctcaactgaccaaggacgacatgaagatg
aaagttcctcggtacgataagtctgcttatagcgggaggggtgacagagccgatgcagaa
acatggcctgaagttgaaggacctctaaaggttattctctttgagggatggatgcttggt
ttcaaacctcttccttctgaagtcgttaaatcagttgatccacagctggagacagtgaat
aagaaccttgaagcgtattatgacgcatgggacaagtacatcaatgcttgggtcatcatc
aaaatcaaggatccaagttatgtataccggtggcgtcttcaggcggaaatcgccatgagg
caggctggcaaagccgggatgtcagatgatgaggtgaatgactttgtgtcacggtatttg
ccggcatataaagcctatcttccgaccctttacgctgaaggacctaccggctctgaccct
gaccgtgtccttgccatagatatcgatgaagaaaggaaccccatactcgctacctaa

DBGET integrated database retrieval system