KEGG   Brassica napus (rape): 106376923Help
Entry
106376923         CDS       T04128                                 

Definition
(RefSeq) beta-glucosidase 19 precursor
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00500  Starch and sucrose metabolism
bna00940  Phenylpropanoid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106376923
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106376923
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    106376923
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     106376923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 106376923
NCBI-ProteinID: NP_001303148
UniProt: Q42618
AA seq 514 aa AA seqDB search
MKFPLLGLLLLVTLVGSPTRAEEGPVCPKTETLSRASFPEGFMFGTATASYQVEGAVNEG
CRGPSLWDIYTKKFPHRVKNHNADVAVDFYHRFREDIKLMKKLNTDALRLSIAWPRIFPH
GRMEKGNSKEGVQFYHDLIDELLKNDLTPLVTIFHWDMPADLEDEYGGFLSERVVPDFVE
YANFTFHEYGDKVKNWITFNEPWVFSRSAYDVGKKAPGRCSPYIKDFGHLCQDGRSGFEA
YVVSHNLLVSHAEAVDAFRKCEKCKGDKIGIAHSPAWFEPEDVEGGQRTVDRVLDFIMGW
HLDPTTYGDYPQSMKDAVGARLPKFTKAQKAKLKGSADFVGINYYSSFYAKASEKPDYRQ
PSWATDSLVEFEPKTVDGSVKIGSQPSTAKMAVYAAGLRKLVKYIKDRYGNPEIIITENG
YGEDLGEKDTDHSVALNDHNRKYYHQRHLLSLHQAICEDKVNVTSYFVWSLMDNFEWLDG
YTARFGLYYIDFQNNLTRMEKESATCSLNSSNRA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcctctcttggggttacttttgctcgtaactcttgtcggctctcctaccagg
gccgaagaaggacctgtttgccctaagactgaaacccttagtcgtgcaagtttcccggag
ggcttcatgtttggtaccgcaaccgcatcctatcaggttgaaggtgcagtaaatgaaggt
tgcagaggaccaagcctgtgggatatctatactaagaaatttcctcatagagttaagaat
cacaatgctgatgtagctgtcgatttctaccatcgtttcagggaggatatcaagttgatg
aaaaagctgaacactgatgctttgagactatccattgcatggccaagaatatttccccat
gggaggatggagaaaggaaatagcaaagaaggagttcaattttaccacgaccttatagac
gagctccttaaaaatgacctaacaccactagtaacgattttccactgggacatgcccgcc
gatttggaagatgagtacggtggctttttgagcgaacgtgtagtgccggattttgtggag
tacgcaaatttcacgttccacgaatatggggacaaagtgaaaaactggattacgttcaac
gagccatgggtctttagccgttcagcctacgacgttgggaagaaagcaccgggacgttgt
tctccgtacatcaaagactttgggcatctttgccaagatggacggtcaggattcgaggct
tatgtcgttagtcacaatcttctcgtcagtcacgctgaagcagttgacgctttcagaaag
tgcgagaagtgcaaaggtgataaaatcgggattgctcatagcccggcttggtttgaacca
gaagatgtggagggaggtcaacgtaccgtagaccgtgtgcttgacttcatcatgggctgg
catttggatcctacgacgtacggagattatcctcaaagtatgaaagatgcggtcggagct
agattgcccaaatttacaaaagcccaaaaggcaaaactgaaagggtcagctgacttcgtg
ggaataaactattacagttccttctatgcaaaggcaagcgaaaagcctgattatcggcaa
ccatcttgggctacagattctctagtcgagtttgaacccaagactgttgatggatccgtt
aagattggtagccagcccagcactgctaagatggctgtatacgcggcgggtttgaggaag
cttgtaaaatacataaaggacagatatggcaaccctgagatcataattactgagaatggt
tatggagaggaccttggcgagaaagatacagatcatagcgttgctctcaatgatcacaac
aggaaatactatcaccagaggcatcttttgtccctacatcaggctatatgtgaagacaag
gtgaatgttacatcttatttcgtgtggtcattaatggacaacttcgagtggctagacggg
tacacagctaggtttggtctctattacatcgacttccagaacaacttgactcgtatggag
aaagaatctgcaacatgctctctgaattcctcaaaccgggcctaa

DBGET integrated database retrieval system