KEGG   Brassica napus (rape): 106376977Help
Entry
106376977         CDS       T04128                                 

Definition
(RefSeq) probable protein S-acyltransferase 7
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
bna  Brassica napus (rape)
Brite
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106376977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Yip1
Motif
Other DBs
NCBI-GeneID: 106376977
NCBI-ProteinID: XP_013672575
AA seq 439 aa AA seqDB search
MYVVPPPESGSGSDRDLRVYQTWKGSNIFFLQGRFVFGPDVRSLALTICLIAVPVTIFCI
FVARKLMDDFSDSWGLSIVAVAVVFTIYDLILLLVTSGKDPGIIPRNAHPPEPEALDGNM
DAGAGQTPQLRLPRIKEVEVNGITFKVKYCDTCMLYRPPRCSHCSICNNCVGKFDHHCPW
VGQCIGLRNYRFFFMFVFSTTLLCIYVHAFCWVYIRKITDSEHTTIWKAMLKTPASIVLI
IYTFISMWFVGGLTAFHLYLISTNQTTYENFRYRYDRRSNPHNKGVVNNFKETFCSAIPP
SKNDFRALVHREPPLPPRSVAGGFMSPNMGKANDDIEMGRKAVWADMGPAMSEHGTNNER
LHVKDGELGELSPEVRTTVDEQSDRPGVHPRRSSWGRKSGSWDMSPEVMALAGRVGGEQN
QNRGGSSSGSGLVTENRHS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtagtgcctccgcctgaatccggttcgggatccgaccgtgatttaagggtttac
caaacttggaaaggcagcaatatattctttcttcaggggagatttgtattcgggccagac
gtaagatcactggccctgacaatatgtctcattgctgttcccgttactattttctgcatc
tttgtcgcgaggaagctaatggatgacttctctgatagctggggactatctatagtagct
gttgccgtcgtcttcaccatttatgatttaattcttctgctggttacatccggaaaagat
ccaggaatcatcccgagaaacgctcatcctccagagcctgaagcactcgatggcaacatg
gatgcaggagctggccagactcctcagctgcggctgcctcgcattaaggaagtagaggtt
aatggaatcacatttaaggtcaagtactgtgacacttgcatgctctatagaccgcctcgc
tgttcccattgctcgatttgtaacaactgcgttggaaagtttgaccatcactgcccttgg
gtaggccaatgtatcggtctgaggaactacagattcttcttcatgtttgtcttctccacg
acccttctctgtatatatgttcatgccttctgctgggtgtatataaggaagatcactgac
tcagagcatacaactatttggaaggcaatgctcaaaactcctgcctccattgtattgata
atctacacattcatatcgatgtggtttgttggtggcttaacagctttccatctgtatctc
atcagcacaaaccagactacatatgagaatttcagatacagatatgataggcgaagcaac
ccacacaacaagggagtggttaacaacttcaaagaaacgttttgttctgcaatacctcct
tcaaagaatgactttagagccttggtccatcgtgaacctccattgcctcctagatctgta
gcaggtgggtttatgagtccaaacatgggtaaagccaacgatgatattgagatgggaagg
aaagctgtttgggcagacatgggtcctgcaatgtcagagcatggtactaacaatgaacgg
ttgcatgttaaggatggtgagttaggcgagctatctcctgaagttaggacaacagttgat
gaacagagcgataggcctggtgtgcatccgaggcgctcgagctggggaaggaaaagcggg
agctgggatatgtcgccagaagttatggccttagcaggcagagtaggaggagaacaaaac
cagaaccgtggaggaagcagcagtggaagtggtctagtgactgagaaccggcattcatag

DBGET integrated database retrieval system