KEGG   Brassica napus (rape): 106379176Help
Entry
106379176         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 2, chloroplastic
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106379176
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106379176
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106379176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 106379176
NCBI-ProteinID: XP_013674638
UniProt: A0A078H4H3
AA seq 406 aa AA seqDB search
MASLALTSPPGVKVPSHLASSSSSLISRSSISFTTIESGSRICVSNSAKCNLPKALTLGN
GNASIPIINGTTLPKYLDSSSRLEKPVSSRRANTKLKLFSGTANPALSQEIAWYMGLELG
KISIKRFADGEVYVQLKESVRGCDVFLVQPTCTPTNENLMELLIMVDACRRASAKKVTAV
IPYFGYARADRKTQGRESIAAKLVANLITEAGVDRVLACDLHSGQSMGYFDIPVDHVYCQ
PVILDYLASKSISSKDLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNL
IGDVKGKVAVMVDDMIDTAGTIVKGAALLHEEGAREVYACCTHAVFSPPAIERLSSGLLQ
EVIVTNTLPVAEKNYFPQLTILSVANLLGETIWRVHDDSSVSSIFL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctagctctgacttctcctcccggcgttaaggttccgtcgcaccttgcctcc
tcgtcttcgtctctcatctcccgctcctcgatttcattcaccaccattgagtctggctcc
cgaatctgcgtttccaattcggcgaaatgcaatttgccgaaagcactgactcttggcaac
gggaacgctagcattccaatcatcaacgggacgacacttccaaagtaccttgattcttct
tcccggttggagaaaccagtgagtagtagaagagccaacacaaagctcaagctcttctct
ggtactgcaaatccagcactttctcaggaaattgcttggtatatgggcttggagcttggc
aagattagcatcaagaggtttgctgatggggaggtctacgttcagctcaaagagagtgtt
agaggctgcgatgtcttcttggtgcagcctacttgcactccgactaatgagaatctcatg
gagctgttgatcatggtggatgcttgccgaagagcttccgctaagaaagttactgctgtg
attccctattttggatacgcaagagctgatagaaagacacaagggcgtgaatccattgct
gccaaactggttgcaaaccttataacggaggcaggtgtggatcgggttcttgcgtgtgat
cttcattcaggacagtccatgggttattttgacatacctgtggatcatgtctattgccag
cctgtgatactagattatcttgctagcaagtcaatttcatcaaaggatttggtagtggtt
tctcctgatgttggtggagttgctagggcacgtgcttttgccaagaaattatccgatgct
ccccttgccattgttgataaaagacgtcacggccacaatgttgctgaggtcatgaaccta
ataggtgatgttaaaggcaaagtggcagtaatggtggatgacatgattgataccgctgga
accattgtgaaaggagcagctcttttgcacgaggagggtgctcgtgaggtttacgcttgc
tgcacgcacgcggttttcagtccgcctgcgatagagcggttatcgagcggtttgctgcaa
gaagtgatagtgacgaatacattaccggtagcggagaagaattacttcccgcagctaacg
atattgtcggtggctaatcttctgggtgagaccatttggcgtgtccatgatgatagctcc
gttagtagcatttttctttga

KEGG   Brassica napus (rape): 106429305Help
Entry
106429305         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 5, chloroplastic isoform X1
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106429305
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106429305
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106429305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 106429305
NCBI-ProteinID: XP_013725506
AA seq 397 aa AA seqDB search
MAFLLHARPSPSLPAADLRRSSPLIHRGPASVRFPLKCKAVDSYGGNSDDLYLLTGDTAP
ASALLSRTRLEDAIKNNTTRLRIFSGTANPSLAQEISCYLGLELGKIKIKRFADGEIYVQ
LQESVRGCDVFLVQPTCPPANENLMELLVMIDACRRASAKTITAVIPYFGYARADRKTQG
RESIAAKLVANLITESGADRVLACDLHSGQSMGYFDIPVDHVYGQPVILDYLASKGISSD
DLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVKGKVAIMVDDM
IDTAGTISKGAALLHQEGAREVYACTTHAVFSPPAISRLSSGLFQEVIITNTIPLSEQNY
FPQLTVLSVANLLAETIWRVHDDCSGDIEPFSTLGID
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcttctccacgcgcgaccttcacctagtttaccggcggcggatctccggcga
tcttctcctctgattcatcgcggtcctgcttccgttcgatttcctctcaagtgtaaggcg
gtggattcgtacggcgggaactccgacgatctgtatctgcttacaggcgacaccgctccc
gcgagcgctcttctctcgaggacgcggttggaggatgcgattaagaataacaccacgcgg
ctccgtatcttctccggcactgctaatccttccttggctcaggagatttcatgctatttg
ggactggagctggggaaaatcaagattaagcggtttgctgatggggagatctatgttcag
ctgcaagagagtgttaggggatgcgatgtgtttcttgtgcagcctacgtgcccacctgct
aatgaaaaccttatggaactgctcgttatgattgacgcttgccgtagagcatctgccaag
accatcactgctgtgattccttactttggatatgctcgagctgatagaaagactcaggga
cgtgaatctattgctgccaagcttgtcgctaatctgataacagagtctggtgcagaccgt
gttcttgcatgtgaccttcactctggacagtctatgggctactttgatattcctgttgac
catgtttatggccagcctgtgatacttgattacctagcaagcaaaggcatatcctctgat
gacttggtggttgtttcgcctgatgttggtggagtcgcaagagctcgcgcttttgccaag
aagctatccgatgctcctttagcgatagtggacaaaagacgtcatgggcacaatgttgca
gaggtgatgaacttaattggggacgttaaagggaaagtagctataatggtggatgacatg
attgacacagcgggaaccataagcaaaggtgcagctctgttacaccaagaaggagcaaga
gaagtctacgcatgtaccactcatgccgtttttagccctcctgcaatcagtagactatcg
agcggtctgtttcaagaggtgataataaccaacacgattccactgtcggagcaaaactac
tttccacagcttaccgttctctcagtagcaaaccttcttgcggagaccatatggcgtgtt
catgatgattgctctggagacattgagccattttcgacattggggattgattga

KEGG   Brassica napus (rape): 106429574Help
Entry
106429574         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 2, chloroplastic-like
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106429574
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106429574
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106429574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 106429574
NCBI-ProteinID: XP_013725776
AA seq 384 aa AA seqDB search
MESLALTSPPGVKVPSYLASSSSSLFSRSSISNSAKCNLPKALNLGNGTTLPKYFDSSSR
LEKPVSTSRANTKLKLFSGTANPALSQEIAWSMGLELGKISIKRFADGEVYVQLKESVRG
CDVFLVQPTCTPTNENLMELLILVDACRRASAKKVTAVIPYFGYARADRKTQGRESIAAK
LVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDYLGSKSISSKDLVVVSP
DVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVKGKVAVMVDDMIDTAGTI
VKGAALLHEEGAREVYACCTHAVFSPPAIERLSSGLLQEVIVTNTLPVAEKNYFPQLTIL
SVANLLGETIWRVHDDSSVSSIFL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgctagctctgacttctcctcccggcgttaaggttccgtcgtaccttgcctcc
tcgtcttcgtctctcttctcccgctcctcgatttccaattcggcgaaatgcaatttgccg
aaagcactgaatcttggcaacgggacgacacttccaaagtactttgattcttcttcccgg
ttggagaaaccagtgagtactagtagagccaacacaaagctcaagctcttctctggtact
gcaaatccagccctttctcaggaaattgcttggtctatgggcttggagcttggcaagatt
agcatcaagaggtttgctgatggggaggtctacgttcagctcaaagagagtgttagaggc
tgcgatgtcttcttggtgcagcctacttgcactccaactaatgagaatctcatggagctt
ttgatcttggtcgatgcttgccgtagagcttccgctaagaaagttactgctgtgattccc
tactttggatacgcaagagctgatagaaagacacaagggcgtgaatccattgctgccaaa
ctggttgcaaaccttataacggaggcaggtgcggatcgggttcttgcgtgtgatcttcat
tcaggacagtccatgggttattttgacatacctgtggatcatgtctattgccagcctgtg
atactagattatcttggtagcaagtcaatttcatcaaaggatttggtagtggtttctcct
gatgttggtggagttgctagggcacgtgcttttgccaagaaattatccgatgctcccctt
gccattgttgataaaagacgtcacggccacaatgttgctgaggtcatgaacctaataggt
gatgttaaaggcaaagtggcagtaatggtggatgacatgattgataccgctggaaccatt
gtgaaaggagcagctcttttgcatgaggagggtgctcgtgaggtttacgcttgctgcacg
cacgcggttttcagtccgcctgcgatagagcggctatcgagcggtttgctgcaagaagtg
atagtgacgaatacattaccagtagcggagaagaattacttcccgcagctaacgatattg
tcggttgctaatcttctgggtgagaccatttggcgtgtccatgatgatagctccgttagt
agcatttttctatga

KEGG   Brassica napus (rape): 106429625Help
Entry
106429625         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 5, chloroplastic-like
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106429625
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106429625
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106429625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N NifU
Motif
Other DBs
NCBI-GeneID: 106429625
NCBI-ProteinID: XP_022554889
AA seq 185 aa AA seqDB search
MAFLLHARPSPSLPAADLRRPSPLIHRGPASVRFPLRCKAVDSYGGNSDDLYLLTGDTAP
ASALLSRTRLEDAIKNNTTRLRIFSGTANPSLAQEISCYLGLELGKIKIKRFADGEIYVQ
LQESVRGCDVFLVQPTCPPANENLMELLVMIDACRRASAKTITAVIPYFGYARADRKASP
LCLYY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcttctccacgcgcgaccttcacctagtttaccggcggcggatctccggcga
ccttctcctctgattcatcgcggtcctgcttccgttcgatttcctctcaggtgtaaggcg
gtggattcgtacggcgggaactccgacgatctgtatctgcttacaggcgacaccgctccc
gcgagtgctcttctctcgaggacgcggttggaggatgcgattaagaataacaccacgcgg
ctccgtatcttctccggcactgctaatccttccttggctcaggagatttcatgctatttg
ggactggagctggggaaaatcaagattaagcggtttgctgatggagagatctatgttcag
ctgcaagagagtgttaggggatgcgatgtgttccttgtgcagcctacatgcccacctgct
aatgaaaaccttatggaactgctcgttatgattgacgcctgtcgtagagcatctgccaag
accatcactgctgtgattccttactttggctatgctcgagctgatagaaaggcaagtcct
ttatgcttgtactattag

KEGG   Brassica napus (rape): 106437126Help
Entry
106437126         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 5, chloroplastic-like
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106437126
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106437126
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106437126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 106437126
NCBI-ProteinID: XP_013733503
AA seq 397 aa AA seqDB search
MAFLLHAQPSHSLPAADLRRPSPLIHRGPASVRFPLRCKAVDSYGGNSDDLYLLTGDTAP
ASALLSRTRLEDAIKNNTTRLRIFSGTANPSLAQEISCYLGLELGKIKIKRFADGEIYVQ
LQESVRGCDVFLVQPTCPPANENLMELLVMIDACRRASAKTITAVIPYFGYARADRKTQG
RESIAAKLVANLITESGADRVLACDLHSGQSMGYFDIPVDHVYGQPVILDYLASKGISSD
DLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVKGKVAIMVDDM
IDTAGTISKGAALLHQEGAREVYACTTHAVFSPPAISRLSSGLFQEVIITNTIPLSEQNY
FPQLTVLSVANLLAETIWRVHDDCSGDIEPFSTLGID
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcttcttcacgctcagccttcacatagtttaccggcggcggatctccggcga
ccttctcctctgattcatcgcggtcctgcttccgttcgatttcctctcaggtgtaaggcg
gtggattcgtacggcgggaactccgacgatctgtatctgcttacaggcgacaccgctccc
gcgagtgctcttctctcgaggacgcggttggaggatgcgattaagaataacaccacgcgg
ctccgtatcttctccggcactgctaatccttccttggctcaggagatttcatgctatttg
ggactggagctggggaaaatcaagattaagcggtttgctgatggagagatctatgttcag
ctgcaagagagtgttaggggatgcgatgtgttccttgtgcagcctacatgcccacctgct
aatgaaaaccttatggaactgctcgttatgattgacgcctgtcgtagagcatctgccaag
accatcactgctgtgattccttactttggctatgctcgagctgatagaaagactcaggga
cgtgaatctattgctgccaagcttgtcgctaatctgataacagagtctggtgcagaccgt
gttcttgcctgtgaccttcactctggacagtctatgggctactttgatattcctgttgac
catgtttatggccagcctgtgatacttgattacctggcaagcaaaggcatatcctctgat
gacttggtggttgtttcgcctgatgttggtggagttgcaagggctcgcgcttttgccaag
aagctatccgatgctcctttagcaatagttgataaaagacgtcatgggcacaatgttgca
gaggtgatgaacttaatcggggatgttaaagggaaagtagctataatggtggatgacatg
attgacacagcgggaaccataagcaaaggtgcagctctgttacaccaagaaggagcaaga
gaagtctacgcatgtaccactcatgccgtttttagccctcctgcaatcagtagactatcg
agcggtctgtttcaagaggtgatcataaccaacacgattccactgtcggagcaaaactac
tttcctcagcttacagttctctcagtagcaaaccttcttgcggagaccatatggcgtgtt
catgatgattgctctggagacattgagccattttcgacattggggattgattga

KEGG   Brassica napus (rape): 106437498Help
Entry
106437498         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 2, chloroplastic
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106437498
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106437498
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     106437498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 106437498
NCBI-ProteinID: XP_013733847
AA seq 397 aa AA seqDB search
MASMALTSPPGVKIPSYMAASSSSSLFSRSSISFRTVESRSRICVSSSAKCNLNGNARIP
IINETTLPKYFDSSRLEKSASRANTKLKLFSGTANPALSQEIAWYMGLELGKISIKRFAD
GEVYVQLKESVRGCDVFLVQPTCTPTNENLMELLIMVDACRRASAKKVTAVIPYFGYARA
DRKTQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDYLAS
KSISSKDLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVKGKVA
VMVDDMIDTAGTIVKGAALLHEEGAREVYACCTHAVFSPPAIERLSSGLLQEVIVTNTLP
VAEKNYFPQLTILSVANLLGETIWRVHDDSSVSSIFL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatggcactgacttctcctcccggcgttaagattccttcttacatggcagcc
tcctcgtcttcgtctctcttctcccgctcctcgatttcattcaggaccgttgaatctcgc
tcccgtatctgcgtttccagttccgcgaaatgcaatttgaacgggaacgctcgtatccca
atcatcaatgagacgacacttccaaagtactttgattcttcccggttggagaaatcggcc
agtagagccaataccaagctcaagttgttctctggcactgccaatccagcgctttctcag
gaaatcgcttggtatatgggcttggagcttgggaagatcagcataaagaggtttgctgat
ggagaggtctacgttcagctgaaagaaagcgttagaggctgtgatgtcttcttggtgcag
cctacttgcactccaactaatgagaatctcatggagcttttgatcatggtggatgcttgc
agaagagcgtccgctaagaaagtcacagctgtgattccttattttggatacgcgagagct
gacagaaagacacaagggcgtgaatccattgctgccaaactggtggcgaaccttataaca
gaagctggtgcggatcgggttcttgcatgtgatcttcattcaggacagtccatgggttat
ttcgacatacccgtggatcatgtctattgccagcctgtgatacttgattaccttgctagc
aagtcgatttcctcaaaggatttggttgtggtttctcctgatgttggtggagtagcaagg
gcacgtgcttttgctaagaagttatctgatgctccactcgctattgttgataaaaggcgc
cacggccacaatgttgccgaggtcatgaacctaatcggtgatgttaaaggcaaagttgct
gtaatggtagatgacatgattgataccgctggaaccattgtgaaaggagcagctcttcta
catgaggagggtgctcgtgaggtttacgcttgctgcacgcatgcggttttcagtccgcca
gcgatagagcggttatcgagcggtttgctgcaagaagtgatagtgacgaatactttaccg
gtagcggagaagaattacttcccgcagctaacgatattatcggtggctaatcttctgggt
gagaccatttggcgtgtccatgatgatagctccgttagcagcatttttctttga

KEGG   Brassica napus (rape): 111205062Help
Entry
111205062         CDS       T04128                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 1, chloroplastic
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00230  Purine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111205062
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111205062
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     111205062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 111205062
NCBI-ProteinID: XP_022556127
AA seq 399 aa AA seqDB search
MASLALSFPPAAAKTPSYLSSSSSTFFSSFLSFTTSQSHSRNSVFASIKCDLGNGNPSIP
IINERTLPKFLESARMEKSANRTNNNTRLKLFSGTANPALSQEIAWYMGLDLGKIKIKRF
ADGEIYVQLEESVRGCDVYLVQPTCTPTNENLMELLIMVDACXRASAKKVTAVIPYFGYA
RADRKTQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDYL
ASKSIAAEDLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRSGHNVAEVMNLIGDVKGK
VAVMVDDMIDTAGTIVKGAALLHQEGAREVYACCTHAVFSPPAIERLSGGLLQEVIVTNT
LPVAEKNYFPQLTILSVANLLGETIWRVHDDSSVSSIFL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctggctttgtcctttcctcccgccgccgctaaaacgccgtcgtatttgtcc
tcgtcgtcttcgactttcttctcctcttttctctcgtttactacctctcagtctcactcc
cgaaactctgtcttcgcttctattaaatgcgatcttgggaatgggaacccaagcatccca
atcatcaacgagaggacactcccaaagttcttagaatccgcacggatggagaaatcagcc
aacagaaccaacaacaacaccaggctcaagctattctccggcaccgcgaatccagcgctc
tctcaagagatcgcttggtacatgggcttggacctcggcaagatcaagatcaagagattc
gctgacggagagatctacgttcagctggaagagagcgtcagggggtgcgacgtctacttg
gtgcagcccacttgcactccgactaacgagaatctgatggagcttttgatcatggtagac
gcttgtanaagagcgtctgccaagaaagttacggctgtgattccttattttggatatgcc
agagctgacaggaagacacaagggcgtgaatccattgctgctaaattggttgctaacctt
attaccgaagctggtgcagatcgagtgcttgcttgtgatcttcattcaggacagtctatg
ggttatttcgacattccggtggatcatgtgtactgccagccggtgatacttgattatcta
gctagcaagtcaattgcggcagaggatttggtagtggtttctcctgatgttggtggagta
gccagagcacgcgcttttgctaagaagctatcagatgcgccacttgcaattgttgataaa
aggcgttcaggacacaatgttgctgaggtgatgaacctaattggtgatgtaaaagggaag
gtggcagtaatggttgatgatatgattgataccgctggaaccattgtgaaaggagcagct
ttgttacaccaagagggtgctcgggaggtatatgcgtgttgcactcacgctgttttcagc
ccgcctgcgatagagagattatcaggaggtttgcttcaagaagtgatagtgacaaatact
ttgccagtagctgagaagaattacttcccgcagttgacgattttgtcggtggctaatctt
cttggtgagacgatttggcgtgtccatgatgatagctccgtcagcagcattttcctttga

DBGET integrated database retrieval system