KEGG   Brassica napus (rape): 106380498Help
Entry
106380498         CDS       T04128                                 

Definition
(RefSeq) alpha-humulene/(-)-(E)-beta-caryophyllene synthase-like isoform X1
  KO
K14184  alpha-humulene/beta-caryophyllene synthase [EC:4.2.3.104 4.2.3.57]
Organism
bna  Brassica napus (rape)
Pathway
bna00909  Sesquiterpenoid and triterpenoid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    106380498
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.57  (-)-beta-caryophyllene synthase
     106380498
    4.2.3.104  alpha-humulene synthase
     106380498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth Terpene_synth_C
Motif
Other DBs
NCBI-GeneID: 106380498
NCBI-ProteinID: XP_013675716
AA seq 486 aa AA seqDB search
MENEVQRPLADFPVNIWEDIFTSFSNSDLGSDKLKEKHITLKETVKESFMASRANPIENI
KFIDTLCRLGVSYHFEKDITDKLEKSFDCLDFNQKIRQERCDLYTVGIVFQVFRQFGFKL
SADVFNKFKDEDGKFKAHLVADARGMLTLYEAAQWSTPGEDILDEALAFSNAHLEEISSR
SSPHLAIRIKNALKHPFHKGISRIETRKFISYYEAEEKCDSTLLEFAKIDFNLLQMLYRH
ELACVTRWLPEAPNGIPDSMKHLYRTIIDFYDKLEDELEKQGRSGCGFHLKKSLKSTSNG
YMQEVNWLKKDYTAKFDEYKENAILSSAYYAIMGVTFVGMGEVAKLDAFEWLSSHPKIRT
AAEIICRFTDDITSYDVSTNLEFRVLTIYKFEHKREHVATGIDCYMKQFCVSKELAVHGL
FNIVSNAWKELNQELMRPHSFLFPFLMRILNLSRIIDVVYRYEDAYTHPEFLKEHIVSLL
IENIPI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgaagttcagcgtccactagctgattttccagtgaacatctgggaagatatc
ttcacttcgttctcaaattcggatcttggaagtgataaacttaaagagaagcatattact
ctaaaggagactgtgaaggagtcgtttatggcttcaagagcgaacccaatagagaacatc
aagttcattgacacgctatgtcgccttggtgtctcctatcattttgagaaagatatcaca
gacaaactggagaagtcgtttgattgtcttgattttaaccagaagataagacaagagaga
tgtgatttgtacacggttggaatagtttttcaagtttttaggcaattcgggtttaaactt
tctgctgatgtgtttaacaagttcaaggacgaggatgggaagttcaaagcacacttagtg
gctgatgcaaggggcatgttaaccttatatgaagctgcacaatggagcactcctggagaa
gatattcttgatgaagctctcgctttctcaaatgctcatttagaagaaatttcttctcgg
tctagccctcatctcgctatacgcatcaagaacgccctaaaacatccatttcacaaaggc
atctccaggatagaaacgaggaaatttatctcatactacgaggctgaagagaagtgtgac
tcaacattacttgagtttgcaaagatcgactttaatttgttgcagatgctgtaccgccat
gagcttgcttgtgtaacaaggtggcttcccgaagcacctaacgggatacctgacagcatg
aaacacctttaccggaccataatcgatttctatgataaactcgaggatgagcttgagaag
caaggaaggtccggttgtggcttccatcttaaaaaatcattgaaatcaacatccaatgga
tacatgcaagaagtaaactggttgaaaaaggattacactgctaaatttgacgagtataaa
gagaatgcgatcttgtcttccgcttactatgccataatgggcgtgacattcgtcggaatg
ggagaagtggcgaaacttgatgcttttgaatggttaagttcgcatcctaaaattaggaca
gcagcagagattatctgtcgattcacagatgacattactagctatgatgtgagcacaaac
ttggagtttagagtcctaaccatatataaatttgaacacaaaagggaacacgtagcgacg
ggcatcgattgttacatgaagcagttttgtgtttccaaggaattagccgtacatggatta
ttcaatattgtatcaaatgcttggaaggagttgaatcaagagctaatgaggcctcactcg
tttcttttccctttcttgatgcgaattcttaacctttcgcgtatcatcgatgtcgtctac
aggtacgaagatgcttacacccaccccgaattcttaaaagagcacattgtctctttgctc
attgaaaatatccccatttaa

DBGET integrated database retrieval system