KEGG   Brassica napus (rape): 106381166Help
Entry
106381166         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial-like
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106381166
   00620 Pyruvate metabolism
    106381166
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106381166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 106381166
NCBI-ProteinID: XP_022570566
AA seq 487 aa AA seqDB search
MAIYVASRRLSSGTALRAMRSYSTSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG
ERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLNHHFPLVVWQT
GSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPKVMHIAAATEIN
SRLIPSLKTLHSTLHSKSFDFKDIVKIGRTHTQDATPLTLGQEFGGYATQVKYGLHRVTC
TLPRLYQLAQGGTAVGTGLNTKKGFDVKIAAAVAEETNLPFVTAENKFEALAAHDACVET
SGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQCEALTMVC
AQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVRGIEANRER
ISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTAEEFDTLVVPE
KMIGPSD
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttacgtggcgtcacggcgtctctccagcggaacagcgctgcgtgctatgaga
tcgtattcaacgtcgtcatttagggaggagagggacaccttcgggccgatccaagttcct
tccgataaattgtggggagcccagacgcagagatcgctgcagaacttcgagatcggtggc
gagcgcgagcgaatgcccgagcctatcgtccgcgcttttggcgtcttgaagaagtgcgct
gctaaggttaacatggagtatggacttgatccaacgattgggaaagcgattatggaagct
gctcaggaagttgctgagggaaagctcaatcatcatttcccccttgttgtttggcaaact
ggtagtggcactcagagtaacatgaatgctaatgaggtcattgctaacagagcagctgag
attcttggtcgcaaacgtggtgaaaaatgtgtccaccctaatgaccatgtcaacagatct
caatcctctaacgacactttccctaaggtcatgcacattgcagctgcaaccgagattaat
tcaaggctcatccctagtttgaaaactttgcattccactctccactctaagtccttcgac
ttcaaagatattgtgaaaattggaagaactcacactcaagatgccactcctttgacgcta
ggacaagaattcggtggctatgctactcaagttaagtatgggcttcatagggtcacatgc
actctaccccgcctctatcagcttgcacaaggtggaactgctgttggaacaggattaaac
accaagaaagggtttgacgtaaagatagctgctgcagttgccgaagaaacaaatttgccg
tttgtcactgcagaaaacaagtttgaagctctggctgcacacgatgcttgtgttgaaacc
agtgggtcacttaacacaatcgccacatcgttgatgaagatcgccaatgatatacgtttt
cttggaagtggcccaagatgtggtcttggtgaacttgttctgcctgaaaacgagccagga
agcagcatcatgcctgggaaggtgaatcctacacagtgtgaggccttgactatggtttgt
gctcaggttatgggcaaccatgtagctgtgacagttggtgggtcaaatggtcatttcgaa
ttgaatgtatttaagccagtgatcgcaagcgctcttttgcattccattagattggtagca
gatgcttcagcttcgtttgagaaaaactgtgtgaggggaattgaggccaacagagaacgg
atctcaaagctgttgcatgagtcccttatgcttgtgacatcattgaatccgaaaatcgga
tatgacaatgctgcagcagttgccaagaaagctcacaaagaaggatctacattgaaggaa
gcggctctgaagttgggtgttctaacggcagaagagtttgatacgcttgttgttcccgag
aagatgatcggtccctctgattga

KEGG   Brassica napus (rape): 106394343Help
Entry
106394343         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial-like isoform X1
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106394343
   00620 Pyruvate metabolism
    106394343
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106394343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 106394343
NCBI-ProteinID: XP_022544255
AA seq 357 aa AA seqDB search
MNANEVIANRAAEILGGEKCVHPNDHVNRSQSSNDXFPTVMHIAAATEINSRLIPSLKTL
HSTLHSKSFQFKDIVKIGRTHTQDATPLTLGQEFGGYATQVKYGLNRVTCTLPRLYQLAQ
GGTAVGTGLNTKKGFDVKIAAAVAEETNLPFVTAENKFEALAAHDACVETSGSLNTIATS
LMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQCEALTMVCAQVMGNHVAV
TVGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVRGIEANRERISKLLHESLM
LVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTAEEFDTLVVPEKMIGPSD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctaatgaggtcattgctaacagagcagctgagattcttggtggtgaaaaatgt
gtccaccctaatgaccatgtcaaccgatctcaatcctctaacgacantttccctactgtc
atgcacattgcagctgcaactgagattaattcaaggctcatccctagtttgaaaactttg
cattccactctccactctaagtccttccagttcaaagatattgtgaaaattggaagaact
cacactcaagatgctactcctttgacgctaggacaagaatttggtggctacgctactcaa
gttaagtatgggcttaatagggtcacatgcactctaccccgcctctatcagcttgcacaa
ggtggaactgctgttggaacaggattaaacaccaagaaagggtttgacgtaaagatagct
gctgcagtagccgaagaaacaaacttgccgtttgtcactgcggaaaacaagttcgaagct
ctggctgcacacgatgcttgtgttgaaaccagtgggtcacttaacacaatcgccacatcc
ttgatgaagatcgccaatgatatacgttttcttggaagtggcccaagatgtggtcttggt
gagcttgttctgcctgaaaacgagccaggaagcagcatcatgcctgggaaggttaatcct
acacaatgtgaggccttgactatggtttgtgctcaggttatgggcaaccatgtcgctgtg
acagttggtgggtcaaatggtcatttcgaattgaatgtatttaagccagtgatcgcaagc
gctcttttgcattccattagattggtagcagatgcctcagcttcgtttgagaaaaactgt
gtgaggggaattgaggccaacagagaacggatctcaaagctattgcatgagtcccttatg
cttgtgacatcattgaatccgaaaatcggatatgacaatgctgcagcagttgccaagaaa
gctcacaaagaaggatctacattgaaggaagcggctctgaagttgggtgttctgacggca
gaagagtttgatacacttgttgttcccgagaagatgatcggtccctctgattga

KEGG   Brassica napus (rape): 106394354Help
Entry
106394354         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial isoform X1
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106394354
   00620 Pyruvate metabolism
    106394354
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106394354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 106394354
NCBI-ProteinID: XP_013690380
AA seq 492 aa AA seqDB search
MAIYVASRRLSARTTAATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN
FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL
VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA
ATEINSRLIPSLKTLHTTLDSKSFEFKDIVKIGRTHTQDATPLTLGQEFGGYATQVKYGL
NRVTCTLPRIYQLAQGGTAVGTGLNTKKGFDVKIAAAVAEETNLPFVTAENKFEALAAHD
ACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQCEA
LTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVRGIE
ANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTAEEFDT
LVVPEKMIGPSD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttacgtcgcgtcacggcggctttccgccagaacaaccgcggcgacgctgcgt
tacgccactgctctgagatcttattcgacgtcgtttagggaggagagggacaccttcggg
ccgatccaagttccttccgataagttgtggggagcccagacgcagagatcgctgcagaac
ttcgagatcggcggcgagcgcgagcgtatgcccgagccaatcgtccgcgcttttggcgtc
ttgaagaagtgcgctgccaaggtaaacatggagtatggacttgatccaacgattgggaaa
gcgattatgcaagctgctcaggaagttgctgagggaaagctcaatgatcatttccccctt
gttgtttggcaaactggtagtggcactcagagtaacatgaatgctaatgaggtcattgct
aacagagcagctgagattcttggtcgcaaacgtggtgaaaaatgtgtccaccctaatgac
catgtcaacagatctcaatcctctaacgacactttccctactgtcatgcacattgcagct
gcaaccgagattaattcaaggctcatccctagtctgaaaactttgcataccactctcgac
tctaagtccttcgagtttaaagatattgtgaaaattggaagaactcacactcaagatgct
actcctttgacgctaggacaagaatttggtggctatgctactcaggttaagtatggactt
aatcgagtcacatgcactctaccccgcatctatcagcttgcacaaggtggaactgcggtt
gggacaggattaaacaccaagaaagggtttgatgtaaagatagctgctgcagtagccgaa
gaaacaaacctgccgtttgtcactgcagaaaacaagtttgaagctctggctgcacatgat
gcttgtgttgaaaccagtgggtcacttaacacaatcgccacatcgttgatgaagattgcc
aatgatatacgttttcttggaagtggtccaagatgtggtcttggtgaacttgttctgcct
gaaaatgagccaggaagcagcatcatgcctgggaaggtaaatcctacacagtgtgaggcc
ttgactatggtttgtgctcaggtaatgggcaaccatgtagctgtgacagttggtgggtca
aatggtcatttcgaactgaatgtatttaagccggtgattgcaagcgctctcttgcattcc
gtgaggttaatagcagatgcttcagcttcgtttgagaaaaactgtgtaaggggtattgag
gccaacagagaaaggatctcaaagcttttgcacgagtctcttatgcttgtgacatcattg
aatccgaaaatcggatatgacaatgctgcagcagttgccaagaaagctcacaaagaagga
tcgacactgaaggaagcggctctgaagttaggtgttcttaccgctgaagagtttgatacg
cttgttgttcccgagaagatgatcggaccctccgattga

KEGG   Brassica napus (rape): 106394362Help
Entry
106394362         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial-like
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106394362
   00620 Pyruvate metabolism
    106394362
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106394362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1
Motif
Other DBs
NCBI-GeneID: 106394362
NCBI-ProteinID: XP_022556221
AA seq 246 aa AA seqDB search
MAIYVASRRLSARTTAATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN
FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL
VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVSFRSQ
LLALFVVPTNYLLRLCVIDFGTQMPIYNLQSNTPKFEYEPYFENHTNLQRNASIYPYMKP
RRRFKT
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttacgtcgcgtcacggcggctttccgccagaacaaccgcggcgacgctgcgt
tacgccactgctctgagatcttattcgacgtcgtttagggaggagagggacaccttcggg
ccgatccaagttccttccgataagttgtggggagcccagacgcagagatcgctgcagaac
ttcgagatcggcggcgagcgcgagcgtatgcccgagccaatcgtccgcgcttttggcgtc
ttgaagaagtgcgctgccaaggtaaacatggagtatggacttgatccaacgattgggaaa
gcgattatgcaagctgctcaggaagttgctgagggaaagctcaatgatcatttccccctt
gttgtttggcaaactggtagtggcactcagagtaacatgaatgctaatgaggtcattgct
aacagagcagctgagattcttggtcgcaaacgtggtgaaaaatgtgtccaccctaatgac
catgtcaacagatctcaatcctctaacgacactttccctactgtaagctttcgctctcaa
ttgcttgcactgtttgttgttcctactaattatttgttgaggctctgtgttattgatttt
ggcacccagatgcccatttataacctacaatcgaatacccccaaatttgaatatgaaccc
tattttgaaaatcacactaatctacaacgaaatgcttcgatctacccctatatgaaaccc
agaagacgatttaaaacctag

KEGG   Brassica napus (rape): 106422439Help
Entry
106422439         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial-like
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106422439
   00620 Pyruvate metabolism
    106422439
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106422439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C Mito_carr
Motif
Other DBs
NCBI-GeneID: 106422439
NCBI-ProteinID: XP_022549418
AA seq 235 aa AA seqDB search
MAASGAGAATTIATNHPLWVVKTRLQVVSLAQGGTAVGTGLNTKKGFDVKIAAAVAEETN
LPFVTAENKFEALAAHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENE
PGSSIMPGKVNPTQCEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRL
VADASASFEKNCVRGIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKDLH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctggtgctggagctgcaaccaccattgccactaatcatcctctttgggtt
gtcaagactcgtcttcaggtggtcagccttgcacaaggtggaactgctgttggaacagga
ttaaacaccaagaaagggtttgacgtaaagatagctgctgcagtagccgaagaaacaaac
ttgccgtttgtcactgcggaaaacaagttcgaagctctggctgcacacgatgcttgtgtt
gaaaccagtgggtcacttaacacaatcgccacatcgttgatgaagatcgccaatgatata
cgttttcttggaagtggcccaagatgtggtcttggtgaacttgttctgcctgaaaacgag
ccaggaagcagcatcatgcctgggaaggtgaatcctacacaatgtgaggccttgactatg
gtttgtgctcaggttatgggcaaccatgtcgctgtgacagttggtgggtcaaatggtcat
ttcgaattgaatgtatttaagccagtgatcgcaagcgctcttttgcattccattagattg
gtagcagatgcctcagcttcgtttgagaaaaactgtgtgaggggaattgaggccaacaga
gaacggatctcaaagctattgcatgagtcccttatgcttgtgacatcattgaatccgaaa
atcggatatgacaatgctgcagcagttgccaagaaggatctacattga

KEGG   Brassica napus (rape): 106423803Help
Entry
106423803         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial-like
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106423803
   00620 Pyruvate metabolism
    106423803
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106423803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C Mito_carr
Motif
Other DBs
NCBI-GeneID: 106423803
NCBI-ProteinID: XP_022567004
AA seq 260 aa AA seqDB search
MAASGAGAATTIATNHPLWVVKTRLQVVSLAQGGTAVGTGLNTKKGFDVKIAAAVAEETN
LPFVTAENKFEALAAHDACVETSGSLNTIATSLMKIANDLRFLGSGPRCGLGELVLPENE
PGSSIMPGKVNPTQCEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRL
VADASASFEKNCVRGIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTL
KVNTRNSLSFFILISIILEN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctggtgctggagctgcaaccaccattgccactaatcatcctctttgggtt
gtcaagactcgtcttcaggtggtcagccttgcacaaggtggaactgctgttggaacagga
ttaaacaccaagaaagggtttgacgtaaagatagctgctgcagtagccgaagaaacaaac
ttgccgtttgtcactgcggaaaacaagttcgaagctctggctgcacacgatgcttgtgtt
gaaaccagtgggtcacttaacacaatcgccacatcgttgatgaagatcgccaatgattta
cgttttcttggaagtggcccaagatgtggtcttggtgaacttgttctgcctgaaaacgag
ccaggaagcagcatcatgcctgggaaggtgaatcctacacaatgtgaggccttgactatg
gtttgtgctcaggttatgggcaaccatgtcgctgtgacagttggtgggtcaaatggtcat
ttcgaattgaatgtatttaagccagtgatcgcaagcgctcttttgcattccattagattg
gtagcagatgcctcagcttcgtttgagaaaaactgtgtgaggggaattgaggccaacaga
gaacggatctcaaagctattgcatgagtcccttatgcttgtgacatcattgaatccgaaa
atcggatatgacaatgctgcagcagttgccaagaaagctcacaaagaaggatctacattg
aaggtaaacacaagaaactctttatccttcttcatcctgatatcaatcatacttgaaaat
tga

KEGG   Brassica napus (rape): 106450437Help
Entry
106450437         CDS       T04128                                 

Definition
(RefSeq) fumarate hydratase 1, mitochondrial
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106450437
   00620 Pyruvate metabolism
    106450437
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     106450437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 106450437
NCBI-ProteinID: XP_013747543
AA seq 492 aa AA seqDB search
MAIYVASRRLSARTTAAALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN
FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLNDHFPL
VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPSVMHIAA
ATEINSRLIPSLKTLHTALDSKSFEFKDIVKIGRTHTQDATPLTLGQEFGGYATQVKYGL
NRVTCTLPRLYQLAQGGTAVGTGLNTKKGFDVKIAAAVAEETNLPFVTAENKFEALAAHD
ACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQCEA
LTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVRGIE
ANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEEFDT
LVVPEKMIGPSD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttacgtcgcatcacggcggctttccgccagaacaaccgcggcggcgctgcgt
tacgccactgctctgagatcttattcgacctcgttcagggaggagagggacaccttcggc
ccgatccaagttccttccgataagttgtggggagcccagacgcagagatcgctgcagaac
ttcgagatcggcggcgagcgcgagcgaatgcccgagccaatcgtccgcgcttttggcgtc
ttgaagaagtgcgctgccaaggttaacatggagtatggacttgatccaactattgggaaa
gcgattatggaagctgctcaggaagttgctgagggcaaactcaatgatcatttccccctt
gttgtttggcaaactggtagtggcactcagagtaacatgaatgctaatgaggtcattgct
aacagagcagctgagattcttggtcgcaaacgtggtgaaaaatgtgtccaccctaatgac
catgtcaacagatctcagtcttctaacgacactttccctagcgtcatgcacattgcagct
gcaaccgagattaattcaaggctcatccctagtctgaaaactttgcataccgctctcgac
tctaagtccttcgagtttaaagatattgtgaaaattggaagaactcacactcaagatgct
actcctttgactctaggacaagaatttggtggctatgctactcaggttaagtatggactt
aatcgagtcacatgcactctaccccgcctctatcagcttgcacaaggtggaactgcggtt
gggacaggattaaacaccaagaaagggtttgatgtaaagatagctgctgcagtagccgaa
gaaacaaacctgccgtttgtcactgcagaaaacaagtttgaagctctggctgcacatgat
gcttgtgttgaaaccagtgggtcacttaacacaatcgccacatcgttgatgaagattgcc
aatgatatacgttttcttggaagtggtccaagatgtggtcttggtgaacttgttctgcct
gaaaatgagccaggaagcagcatcatgcctggcaaggtaaatcctacacagtgtgaggcc
ttgactatggtttgtgctcaggtaatgggcaaccatgtagctgtgacagttggtgggtca
aatggtcatttcgaactgaatgtatttaagccggtgattgcaagcgctctcttgcattcc
gtgaggttaatagcagatgcttcagcttcgtttgagaaaaactgtgtaaggggtattgag
gccaacagagaaaggatctcaaagctattgcacgagtctcttatgcttgtgacatcattg
aatccgaaaatcggatatgacaatgctgcagcagttgccaagaaagctcacaaagaagga
tcgacactgaaggaagcggctctgaagttaggtgttcttacttctgaagagtttgatacc
cttgttgttcccgagaagatgatcggtccctccgattga

DBGET integrated database retrieval system