KEGG   Brassica napus (rape): 106382678Help
Entry
106382678         CDS       T04128                                 

Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
bna  Brassica napus (rape)
Pathway
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
Module
bna_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106382678
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     106382678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 106382678
NCBI-ProteinID: XP_013678175
AA seq 209 aa AA seqDB search
MENGKRDREDMEVQLSPRKPRVLLAATGSVAAIKFGNLCHCFTEWAEVRAVVSKSSLHFL
DKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVMVIAPLSANTLAKIAGGMCDN
LLTCIIRAWDYSKPLFVAPAMNTLMWNNPFTERHLLSLDELGITLIPPIKKRLACGDYGN
GAMAEPSLIYSTVRLFWESQAHQQSGGTS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgggaaaagagacagagaagacatggaagtgcagctctcccctagaaagccc
cgcgtactcctcgcagcaaccggaagcgtcgccgccatcaaattcggcaacctctgccac
tgcttcacagagtgggcggaagtgagagccgtcgtctcgaaatcgtctctccacttcctc
gacaagctctctctcccacaggaagtgactctctacaccgacgaagacgagtggtcgagc
tggaacaagatcggcgatcccgtgcttcacatcgagctcagacgctgggctgacgtcatg
gtcatcgctcctttgtctgctaacactttagccaagatagctggtgggatgtgtgataat
cttctgacttgtatcataagagcttgggattatagcaaaccgcttttcgttgcgccggct
atgaatactttgatgtggaacaatccttttacggagaggcatcttttgtcgcttgatgag
cttggaatcactcttattcctccgatcaagaagaggttggcttgtggtgactatggtaat
ggcgcgatggctgagccgtctcttatctattccactgttagactcttctgggagtctcag
gctcatcagcaaagtggtggaactagttaa

DBGET integrated database retrieval system