KEGG   Brassica napus (rape): 106384088Help
Entry
106384088         CDS       T04128                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
bna  Brassica napus (rape)
Pathway
bna03013  RNA transport
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106384088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bna03012]
    106384088
Translation factors [BR:bna03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106384088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI LPD13
Motif
Other DBs
NCBI-GeneID: 106384088
NCBI-ProteinID: XP_022553303
AA seq 655 aa AA seqDB search
MAHFAKPENALKRADELINVGQKQDALQALHDLITSKRYRAWQKPLEKIMFKYLDLCVDL
KRGRFAKDGLIQYRIVCQQVNVSSLEEVIKHFLHLSTEKAEQARSQADALEEALDVDDLE
ADRKPEDLQLSIVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
KAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRFDQLKV
ATELGLWQEAFRSVEDIYGLMCMVKKTPKSSLLMVYYSKLTEIFWISSSHLYHAYAWFKL
FSLQKNFNKNLSQKDLQLIASSVVLAALSVPPFDRTQSASHMELENEKERNLRMANLIGF
NLEPKFEGRDMLSRSALLSELVSRGVLSCASQEVKDLFHVLEHEFHPLDLGSKIQPLLEK
ISKSGGKLSSAPSLPEVQLSQYVPSLEKLATLRLLQQVSKIYQTIRIESLSQLVPFFEFS
VVEKISVDAVKNNFVAMKVDHMKGVVIFGNLGIESDGLKDHLAVFAESLNKVRAMLYPVP
SKASKLGGIVPNLAETVEKEHKRLLARKSIIEKRKEDQERQQLEMEREEEQKRLKLQKLT
EEAEQKRLAAELLERRKQRILREIEEKELEEAQALLEDTEKRMKKGKKKTLLFMV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgcattttgccaagcctgagaacgcattgaagcgtgctgatgaattgatcaatgtt
ggacagaaacaagatgccctccaggcgcttcacgatctcatcacctccaagaggtaccga
gcatggcagaagccgctcgaaaagatcatgttcaagtatctggacctttgtgtcgacttg
aagagaggtcggttcgctaaagatgggttgatccagtaccgtatcgtttgccagcaagtg
aatgtgagctcgttggaggaagtcatcaagcacttcctgcatctttctaccgagaaggct
gagcaggctcgctctcaggctgatgctctggaggaggcacttgatgtcgatgaccttgag
gctgacaggaagcctgaagatttgcagctgagtattgtcagtggagagaaggggaaagat
agatctgaccgtgagttggttaccccttggtttaagttcctgtgggagacttacaggact
gtgcttgagatattgcgtaacaactcaaagttggaagcgctttatgcgatgacagcacat
aaggccttccagttctgtaagcagtacaagcgaacaaccgagttccgcaggctttgtgaa
atcattagaaaccatttggcaaacctgaacaagtacagagaccaaagggacaggcctgac
ttgtcagccccagagagcttgcagctttacctggacacaagatttgatcagctgaaagtt
gctactgagcttggactttggcaggaagctttccgttctgttgaagatatatatggatta
atgtgcatggtcaagaaaacgcccaagtcatctttgttgatggtctactattccaaattg
actgagatcttctggatttcttctagccatctgtaccatgcttatgcatggttcaagctg
tttagtctgcagaaaaatttcaacaagaacttgagccaaaaggatttgcagctaatagca
tcttctgttgtcttggcggcgttatctgttccgccgtttgatagaactcagagtgcatcc
catatggagcttgaaaacgagaaagaacgcaatttgaggatggccaacctcattggtttc
aatcttgaacctaaatttgagggcagagatatgctttcaaggtcagctcttctgtcagag
ctggtttcaagaggtgttttgagctgtgcatcacaggaggtcaaagatcttttccatgtt
ttggagcatgagtttcacccacttgatcttggctccaagattcagccgttgctggaaaag
atttccaaatctggtgggaagctttcatcagctccttctttgccagaagtgcaactctcc
cagtatgttccttctttggagaagcttgctactctgaggctacttcaacaggtgtctaag
atctatcagactatacgaattgagagtttatctcagttggtccccttctttgaattctca
gtggtagagaagatatctgttgatgctgtgaagaacaactttgttgccatgaaagttgat
cacatgaagggtgttgttatttttggcaatttggggattgagtctgatggactgaaggat
catctggctgtttttgctgagtctttgaacaaagttagagctatgctgtatcctgtccca
agtaaagcatcaaaactaggtggcattgtaccgaacctagcagaaactgttgagaaggag
cacaagagactgcttgctcggaaatcaatcattgaaaagaggaaagaggatcaagagcgt
cagcaactagaaatggaacgtgaggaggaacagaaacggcttaagcttcagaagctaact
gaggaggcagagcaaaagagacttgcggcagagcttctggagagaaggaaacaaagaatc
cttagagagatagaggagaaggaacttgaggaagctcaggcgttgctggaggacacagag
aaacgcatgaaaaagggaaagaaaaagacgcttttgtttatggtctga

DBGET integrated database retrieval system