KEGG   Brassica napus (rape): 106386268Help
Entry
106386268         CDS       T04128                                 

Definition
(RefSeq) venom phosphodiesterase 2-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00230  Purine metabolism
bna00240  Pyrimidine metabolism
bna00500  Starch and sucrose metabolism
bna00740  Riboflavin metabolism
bna00760  Nicotinate and nicotinamide metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106386268
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106386268
   00240 Pyrimidine metabolism
    106386268
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    106386268
   00760 Nicotinate and nicotinamide metabolism
    106386268
   00770 Pantothenate and CoA biosynthesis
    106386268
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bna04090]
    106386268
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bna00537]
    106386268
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     106386268
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     106386268
CD molecules [BR:bna04090]
 Proteins
  106386268
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bna00537]
 Enzymes
  106386268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Sulfatase Metalloenzyme DUF229
Motif
Other DBs
NCBI-GeneID: 106386268
NCBI-ProteinID: XP_013681591
AA seq 446 aa AA seqDB search
MISYATVSAKKPISSCFIFAFLFFSSRNAVVSLNQVSKSQPVARPLKKLDKHVVLLISSD
GFRFGYQFKTNLPNIHRLIANGTEAETGLIPVFPTVTYPNHYSIVTGLYPAHHGIINNNF
VDPKTGDVFTMASHEPEWWLGEPLWETAVNQGLKAATYIWPGSEVHKGSWDCPKGFCQHY
NSSVPDGDGDDDDRVDTILRYFDLPYNDIPSFITIHFNDPDPQGHQVGPDDSLITEAVVN
VDRLIGRFIDGLEKRGVFEDVSMIMVGDHGMVGTCDKKVIVLDDLSPWIKIPSGWVQNYT
PLLAIKPPSGHDAKDVVAKMNQGLRSGKVENGKYLKVYLKEDLPKRLHYADSDRIAPIIG
LVDEGYKVEQKKSKGKECGGAHGYDNAFFSMRSIFIGHGPLFSRGRKVASFENVEIYNLI
CSILGLKAAPNNGSDEFPSKVLLPRK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatctcctacgcgacagtatcagctaaaaagcccatctcaagctgcttcatcttcgcc
ttcctcttcttctcttctcgaaacgccgtcgtttctctaaaccaagtctcaaagtcacaa
cccgtggctcgcccactcaagaaactcgacaagcacgtggttctactaatctcctcagac
gggtttcgtttcgggtaccagttcaagaccaacctaccaaacatccaccgtttgatcgcc
aacgggacagaagccgaaacaggtctaatccccgtttttccgacagtaacttaccccaac
cactactccatcgtcacaggcctataccctgcgcaccacggcatcatcaacaacaacttc
gtggatccgaaaacaggagacgttttcactatggccagccacgagccggagtggtggcta
ggcgagccgctttgggaaacggcagtgaaccaagggctcaaggcggctacttacatctgg
cctggctctgaggtacataagggatcttgggattgtcctaaaggtttctgtcaacactac
aatagctctgttcctgatggtgatggtgatgatgatgatagggttgataccatcttgaga
tatttcgatttgccttataatgacatccctagtttcataacgattcattttaacgatcct
gatcctcaaggtcaccaggttggtcctgatgattctctgatcactgaagctgttgttaac
gtcgaccggttgataggaaggtttatcgacgggttggagaagagaggggtctttgaggat
gtgagtatgatcatggttggtgatcatggaatggttgggacttgtgataagaaagtcatc
gttcttgatgatttatctccttggatcaagatccctagcggatgggttcagaactacact
ccgttgctagcgattaaaccgccttcaggtcacgatgctaaggatgtggtggctaagatg
aaccaaggcctgaggtcaggtaaagtggagaacgggaagtacttgaaagtttatctcaaa
gaggacttaccaaaaaggcttcattacgcagacagtgatcgtatcgcacctatcatagga
ctggtcgatgaagggtacaaggttgagcagaagaagagtaaaggcaaggaatgtggtgga
gctcacgggtatgacaatgcgttcttttcgatgagaagtatattcatagggcatggtcct
ttgttctcaagaggaaggaaagtggcttcttttgagaatgttgagatatataatctgata
tgttcgatacttggacttaaggctgctcctaataacgggtctgatgagtttccttcaaag
gttctcttgccacgcaagtaa

DBGET integrated database retrieval system