KEGG   Brassica napus (rape): 106387895Help
Entry
106387895         CDS       T04128                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106387895
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     106387895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 106387895
NCBI-ProteinID: XP_013683286
AA seq 504 aa AA seqDB search
MFLIKNLRRISPTTSSALIGFRNTGSPPLSSRFCTTLHQPQQVQTPAPNGLDRSRYEGLA
PTREGEKPRVVVLGSGWAGCRLMKGIDTSIYDVVCVSPRNHMVFTPLLASTCVGTLEFRS
VAEPISRIQPAISREPGSFFFLANCSRLDADSHEVHCETLTDGLNTLKPWKFKIAYDKLV
VACGAEASTFGIQGVLENAIFLREVHHAQEIRRKLLLNLMLSDTPGISKEEKQRLLHCVV
VGGGPTGVEFSGELSDFIMKDVRQRYAHVKDDVHVTLIEAKDILSSFDDRLRRYAIKQLN
KSGVRFVRGIVKDVKPQKLILDDGTEVPYGLLVWSTGVGPSPFVSSLDLPKAPGGRIGID
QWMRVPSVQDVFAIGDCSGYLETTGKPTLPALAQVAEREGKYLANLLNEIGKANGGRANS
AKEIALGVPFVYKHLGSMATIGRYKALVDLRESKDAKGISMTGFVSWFIWRSAYLTRVIS
WRNRFYVAINWFTTFVFGRDISRI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgatcaagaacctcagacgaatctcgccgacaacctcctcggccctgatcggc
ttccgaaacaccggatcaccccctctctcctcccgtttctgcaccactcttcatcaaccc
caacaggtccagactccggctcccaatggattggatcggagccgttacgaaggtttggca
ccgacgagagaaggagagaaaccgagagtggtggttctcgggtcgggctgggcgggttgt
cgtttgatgaaagggatcgatacgagcatctacgacgtcgtttgcgtttcccctaggaac
cacatggtcttcactcctctcctcgcttctacctgcgtaggcactctcgagttcaggtcc
gtcgctgagcctatctctcgtatccagcctgccatctcgagagagcccggctcgttcttc
ttcctcgctaattgctctcgccttgatgctgattctcatgaggttcactgtgagacttta
actgatggcttgaacacattaaagccgtggaagttcaagatagcttatgacaagcttgtg
gtagcttgcggtgcagaggcctccacttttggaatccaaggagttctagaaaacgccatc
tttctccgtgaggttcaccatgctcaggagattcgcaggaagcttcttctaaacctcatg
ctctctgatactcctggaatatcgaaagaggagaaacagaggctgctccattgcgttgtg
gttggaggtggaccaactggggtggagttcagcggtgaactcagtgacttcatcatgaaa
gatgttcgtcaacggtatgctcatgtgaaggacgatgttcatgttactttgatagaggcc
aaggatatactttcttcattcgatgatcgtctcagacgctatgctatcaagcagttgaac
aaatctggagtgcggtttgtgcgtgggattgtgaaagatgtgaagccgcagaagctaatc
cttgacgatggcacagaagttccctacggactcttagtatggtccactggtgtaggtcct
tctccttttgttagttctcttgatcttccaaaagctcctggtggaagaattggtattgac
caatggatgcgtgtaccttctgtacaagacgtgtttgccattggtgactgcagtggatat
cttgagaccactggaaaaccaacccttcctgctcttgctcaggtagctgagagagaaggc
aaatacttggcgaatctactaaatgagattgggaaagccaatggaggacgagccaacagt
gcaaaggagatagcacttggagttccttttgtgtataagcaccttggaagcatggcaaca
atcggtagatacaaagccctagtggacctccgcgagagcaaggacgcaaaagggatatca
atgactggtttcgtgagctggttcatatggagatccgcttatctgactcgagtcatcagc
tggagaaaccgcttctatgttgctattaactggttcactactttcgtctttggccgtgac
attagccgtatctga

DBGET integrated database retrieval system