KEGG   Brassica napus (rape): 106388766Help
Entry
106388766         CDS       T04128                                 

Definition
(RefSeq) probable protein S-acyltransferase 12
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106388766
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106388766
Membrane trafficking [BR:bna04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    106388766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Pox_F15
Motif
Other DBs
NCBI-GeneID: 106388766
NCBI-ProteinID: XP_013684364
AA seq 291 aa AA seqDB search
MNLFRFCSGLKVLGYFMILLVFAVVAVSYYAVVVNTWWPILIESSHGALTALACLIISLF
HFLLMMLLWSYFTVVFTDPGSVPEHFRRELGGGESLEAGTSTDQRAFGSLGYCPKCRNVK
PPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETMLDVVVLLPSFIK
FFSQALKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSTNTTSVEVHEKNGDVR
WKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDIDP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttccggttctgctccggtctgaaagtcctcggctacttcatgatccttctc
gtcttcgccgtcgtcgccgtttcttactacgccgtcgtggttaacacatggtggccgatc
ttaatcgaaagcagccatggagctctcacagccctcgcatgcctaatcatctctctcttc
catttcctgctgatgatgttgttgtggagctacttcactgtggtctttacggatccaggt
tccgttcctgagcacttcagaagagagcttgggggtggtgagagtttggaagctggtact
tccacagaccaacgagcttttggttctttaggttactgtccgaaatgtcggaatgttaag
ccgcctcgttgccatcactgttctgtctgtcaaagatgtgttctgaagatggatcatcac
tgtgtttggattgtgaactgtgttggagcgcgcaattacaagtttttccttctctttctg
ttgtatacctttctggagacaatgttggatgttgtagtattgcttcctagtttcatcaag
ttcttcagccaagctctgaagcattcatcttctcctgggaaactggcctccctcgttctg
gctttcgttcttaacttagcgttcgttctcagccttctctgtttcgtagtcatgcatctc
tctcttctctcaaccaatactacttcagttgaggttcatgagaaaaacggagatgttaga
tggaagtatgacttgggaaagaagaaaaacttcgagcaggtttttgggaagaagaaagcg
ttttggctcctcccattgtactctaaagatgatctccatagcataacgtcacttcaaggc
cttgagtttccaactcgttctgacatcgatccttga

DBGET integrated database retrieval system