KEGG   Brassica napus (rape): 106389037Help
Entry
106389037         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106389037
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106389037
  09102 Energy metabolism
   00910 Nitrogen metabolism
    106389037
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106389037
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     106389037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 106389037
NCBI-ProteinID: XP_013685005
AA seq 452 aa AA seqDB search
MAPSTPRVVVKVDLKKKPWEQEQPLHNRWHPEIPSVAQVKAGEFFRVEMIDCMAGTVKDN
SSSADIKHADLSMSHCLSGPIRVVDEEGVAAKPGDLLAVEICNLGPLPGHEWGFTASFDR
ENGGGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFPGLTHPGIIGTAPSMELLRIWNER
ERQIEENGVKPFSLCEVVHQRPLANLPKAKGCLLGHIDKEAPEWERIANEAARTLPGREN
GGNCDIKNLSTGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMNGFLELKCEIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDATVAYKRAV
LNAIDYLNKFGYSKEQAYLLLSCCPCEGRISGIVDSPNAVATLAIPIAIFDQDIRPKTRR
IPSGPRIVRKPDVLKSTYDGKLPITKNPSCST
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcgactccaagagtggtggtgaaggttgatctgaagaagaagccatgggag
caagaacagccactgcataacagatggcatcctgagataccatcagtagcacaagttaaa
gctggtgagtttttcagggtggagatgatcgattgcatggcaggtactgttaaggacaat
agctcttcagccgatatcaagcacgcagacctttctatgtctcattgcctaagtgggcct
attagggttgtggatgaggaaggtgttgcagcaaagccaggtgatcttcttgctgttgag
atatgcaacttaggtcctttaccaggacatgagtggggcttcacagcttcgtttgataga
gagaacggcggcggtttcttgactgatcatttcccttgtgccaccaaagctatttggtac
tttgaagggatctacgcctactctcctcaaattcctggagtacggtttccgggtttgacg
caccctggaatcattggcaccgcgccgtccatggaactactgagaatatggaatgaaagg
gagagacagatagaagaaaatggtgtcaagccgttttcactatgtgaggttgttcatcag
aggccactagcaaacctaccaaaggctaaaggatgcctcctagggcacattgacaaggaa
gcacctgaatgggaaaggattgcaaatgaagctgcaaggacattacctggaagagaaaac
ggaggaaactgtgatattaaaaacctaagcacaggctctaagatatatctacctgtgttt
gtggaaggtgctaatctaagcactggcgatatgcatttctctcaaggtgatggtgagatc
tccttctgtggagccattgagatgaatggattcctagaactcaagtgtgaaatcataagg
aatgggatgaaagagtaccttacgccaatgggacctactcctctccatgtcaacccaatc
tttgagataggaccagtggaaccgagattctcggagtggcttgtctttgagggtatcagt
gtcgatgagagcgggagacaacactatcttgatgcaacagtggcttacaaacgggcggtt
cttaacgcaatagattatctcaacaaatttggttactcaaaagaacaggcgtacctgttg
ctctcatgttgtccatgtgaaggaagaatctctgggattgttgattctcccaatgctgtt
gctacactagcaatacctattgccatctttgatcaggacattaggccaaagactcggagg
attccatcaggaccgcggatagtgaggaaaccggacgtactgaagagcacatatgatgga
aagcttccgattacaaagaatccaagctgctcaacatag

KEGG   Brassica napus (rape): 106389913Help
Entry
106389913         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106389913
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106389913
  09102 Energy metabolism
   00910 Nitrogen metabolism
    106389913
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106389913
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     106389913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 106389913
NCBI-ProteinID: XP_013685982
AA seq 452 aa AA seqDB search
MAPATPRVVVKVDLKKRPWEQEQPLHNRWHPEIQPVGEVKAGEFFRVEMVDWTGGAVKDD
DSAEDIKSLDLSTVHYLSGPIKVVDEDGVAAKPGDLLAVEICNLGPLPGDEWGFTASFDR
ENGGGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFPGLTHPGIIGTAPSKELLRIWNER
ERQLEESGLSSLTLCEVVHQRPLANLPIAKGCLLGNMEEGTPEWERIAKEAARTIPGREN
GGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMSGFLELKCEIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDETGRQHYLDATVAYKRAV
LNAIDYLFKFGYSKEQVYLLLSCCPCEGRISGIVDSPNALATLAIPTSIFDQDIRPKTQK
VPAGPRIVRKPDVMKSTYDGKLETTSNPSSSS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgcaactccgagagtggtggtgaaagtggatttgaagaagaggccatgggag
caggaacagcctctgcataacagatggcatcctgagatacaaccagttggtgaggtcaag
gctggtgagttctttagagtggaaatggttgactggactggaggtgcagtcaaagatgat
gactctgctgaggatattaagagcctagacctctccactgttcattacctaagtggaccg
atcaaagttgttgatgaggatggtgttgcagcaaagccaggtgatcttcttgctgttgag
atatgcaacttaggtccattaccaggagatgagtggggcttcacagcttcgtttgataga
gaaaacggcggcggtttcttgactgatcatttcccttgtgccaccaaagctatttggtac
tttgaagggatctatgcctactctcctcagattcctggagtaaggtttccaggtttgaca
cacccaggcatcattggcactgcaccatcaaaagaacttttgagaatatggaatgaaagg
gagagacaattagaagaaagtggtctcagttccctaacactatgtgaggttgtgcatcaa
cgcccacttgcaaacctaccaatagctaaaggatgtctcctagggaacatggaagagggg
acaccggaatgggaaaggattgcaaaggaggctgcgagaacaatcccaggaagagaaaac
ggaggaaactgtgacataaagaacctaagcagaggctctaaaatatatcttccagtgttt
gtggaaggagctaacttaagcactggtgacatgcacttctctcaaggtgatggtgagatc
tctttctgcggagccattgagatgagtggattcctagaactcaagtgtgaaatcataaga
aacgggatgaaggagtaccttacaccaatgggacctacgcctctccacgtgaacccgata
ttcgagataggtccagtggaaccaagattctcagagtggctggtctttgagggtatcagt
gtagatgagacagggagacagcattaccttgatgcaacagttgcttacaagagggcggtt
ctcaatgctatagactatctgttcaagtttggttactcaaaagaacaggtatacctgtta
ctctcatgttgcccatgcgaagggagaatatctgggatagtcgattcaccaaacgcactt
gctacacttgcaatacccacatccatctttgatcaggatatacggccaaagactcaaaag
gttccagcaggacctcggatagtgagaaagccagacgttatgaagagtacatatgatggc
aaacttgaaactacaagtaatccaagttcttcgtcttaa

KEGG   Brassica napus (rape): 106426854Help
Entry
106426854         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106426854
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106426854
  09102 Energy metabolism
   00910 Nitrogen metabolism
    106426854
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106426854
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     106426854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 106426854
NCBI-ProteinID: XP_013723037
AA seq 454 aa AA seqDB search
MAPATPRVVVKVDLKKRPWEQEQPLHNRWHPEIQPVGEVKAGEFFRVEMVDWTGGAVKDD
DSAEDIKSLDLSTVHYLSGPIRIVDEDGVAAKPGDLLAVEICNLGPLPGDEWGFTASFDR
ENGGGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFPGLTHPGIIGTAPSKELLRIWNER
ERQLEESGLSSLTLCEVVHQRPLANLPIAKGCLLGNMEEGTPEWERIAKEAARTIPGREN
GGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMSGFLELKCEIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDATVAYKRAV
LNAIDYLFKFGYSKEQVYLLLSCCPCEGRISGIVDSPNAVATLAIPTSIFDQDIRPKTRK
VPAGPRIVRKADVMKSTYDGKLETTRNPSSSSYS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgcaactccgagagtggtggtgaaagtggatttgaagaagaggccatgggag
caggaacagcctctgcataacagatggcatcctgagatacaaccagttggtgaggtcaag
gctggtgagttctttagggtggaaatggttgactggactggaggtgcagtcaaagatgat
gactctgctgaggatattaagagcctagacctctccactgttcattacctaagtggacct
attaggattgttgatgaggatggtgttgcagcaaagccaggtgatcttcttgctgttgag
atatgcaacttaggtccattaccaggagatgaatggggcttcactgcttcgtttgataga
gagaacggtggcggtttcttgactgatcatttcccttgtgctaccaaagctatttggtac
tttgaagggatctatgcatactctcctcagattcctggagtaaggtttccaggtttgaca
cacccaggcatcattggcactgcaccatcaaaagaacttttgagaatatggaatgaaagg
gaaagacagttagaagaaagtggtctcagttccctaacactatgtgaggttgtgcatcag
aggccactagcaaacctaccaatagctaaaggatgtctcctagggaatatggaagaggga
acaccggaatgggaaaggattgcgaaggaggctgcaagaacaatcccaggaagagaaaac
ggaggaaactgcgacattaaaaacctaagcagaggctctaaaatatatcttccagtgttt
gtggaaggtgctaatctaagcactggtgacatgcatttctctcaaggtgatggtgagatc
tctttctgcggagccattgagatgagtggcttcctagaactcaagtgtgaaatcataaga
aacgggatgaaggagtaccttacaccaatgggaccaacccctctccatgtaaacccgata
tttgagataggtccagtggaaccaagattctcagagtggctggtctttgagggtatcagt
gtagatgagagcgggagacaacattatcttgatgcaacagttgcttacaagagggcggtt
ctcaatgctatagactatctgttcaagtttggttactcaaaagaacaggtatacctctta
ctctcatgttgcccatgcgaagggagaatatctgggatagtagattctccgaacgcagtt
gctacacttgcaatacccacttccatctttgatcaggatatacggccaaagactcgaaag
gttccagcaggacctcggatagtgagaaaggcagacgttatgaagagtacatatgatggc
aaacttgaaactacaaggaatccaagttcttcgtcttatagctaa

KEGG   Brassica napus (rape): 106426855Help
Entry
106426855         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106426855
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106426855
  09102 Energy metabolism
   00910 Nitrogen metabolism
    106426855
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106426855
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     106426855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 106426855
NCBI-ProteinID: XP_013723038
AA seq 452 aa AA seqDB search
MAPSTPRVVVKVDLKKKPWEQEQPLHNRWHPEIPSVAQVKAGEFFRVEMIDCMGGTVKDN
SSSADIKHADLSMSHCLSGPIRVVDEEGVAAKPGDLLALEICNLGPLPGDEWGFTASFDR
ENGGGFLTDHFPCASKAIWYFEGIYAYSPQIPGVRFPGLTHPGIVGTAPSMELLRIWNER
ERQIEENGVKPFSLCEVVHQRPLANLPKAKGCLLGHIDKEAPEWERIAKEAARTLPGREN
GGNCDIKNLSTGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMNGFLELKCDIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDATVAYKRAV
LNAIDYLYKFGYSKEQAYLLLSCCPCEGRISGIVDSPNAVATLAIPISIFDQDIRPKTRK
VPSGPRIVRKPDVLKSTYDGKLPITKNPSCST
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcgactccaagagtggtggtgaaggttgatctgaagaagaagccatgggag
caagaacagccactgcataatagatggcatcctgagataccatcagtagcacaagttaaa
gctggtgagtttttcagggtagagatgatcgattgcatgggaggtactgttaaggacaat
agctcttcagccgatattaagcacgcagacctttctatgtctcattgcctaagtgggcct
attagggttgtggatgaggaaggtgttgcagcaaagccaggtgatcttcttgctcttgag
atatgcaacttaggtccattaccaggagatgagtggggcttcactgcttcgtttgataga
gagaacggcggcggtttcttgactgatcatttcccttgtgccagcaaagctatttggtac
tttgaagggatctatgcctactctcctcagattcctggagtacggtttccgggtttgaca
caccctggaatcgttggcaccgctccatccatggaactcctgaggatatggaatgaaagg
gagagacagatagaagaaaatggtgttaagccgttttcactatgtgaggttgttcatcag
aggccactagcaaacctaccaaaggctaaaggatgcctcctagggcacattgacaaggaa
gcacctgaatgggaaaggattgcaaaggaagctgcaaggacattacctggaagagaaaac
ggaggaaactgtgacattaaaaacctaagcacaggctctaagatatatctacctgtgttt
gtggaaggtgctaatctaagcactggcgatatgcatttctctcaaggcgatggtgagatc
tccttctgcggagccattgagatgaatggattcctagaactcaagtgtgacatcataagg
aatgggatgaaagagtaccttacaccaatgggacctactcctctccatgtgaacccaatc
tttgagataggaccagtggagccgagattctcggagtggcttgtctttgagggtatcagt
gttgatgagagcgggagacaacattatcttgatgcaacagttgcttacaaacgggcggtt
cttaacgccatagattatctctacaaatttggttactcaaaagaacaggcgtacctattg
ctctcatgctgtccatgtgaaggaagaatctctgggattgttgattctcccaatgctgtt
gctacactagcaatacctatttccatctttgatcaggacattaggccaaagactcggaag
gttccatcaggaccgcggatagtgaggaaaccggacgtactgaagagcacatatgatgga
aagcttccgattacaaagaatccgagctgttcaacatag

KEGG   Brassica napus (rape): 111214291Help
Entry
111214291         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC111214291
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111214291
  09102 Energy metabolism
   00910 Nitrogen metabolism
    111214291
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    111214291
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     111214291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 111214291
NCBI-ProteinID: XP_022572591
AA seq 452 aa AA seqDB search
MAPSTPRVVVKVDLKKKPWEQEQPLHNRWHPEIPSVAQVKAGEFFRVEMIDCMAGTVKDN
SSSADIKHADLSMSHCLSGPIRVVDEEGVAAKPGDLLAVEICNLGPLPGHEWGFTASFDR
ENGGGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFPGLTHPGIIGTAPSMELLRIWNER
ERQIEENGVKPFSLCEVVHQRPLANLPKAKGCLLGHIDKEAPEWERIANEAARTLPGREN
GGNCDIKNLSTGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMNGFLELKCEIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDATVAYKRAV
LNAIDYLNKFGYSKEQAYLLLSCCPCEGRISGIVDSPNAVATLAIPIAIFDQDIRPKTRR
IPSGPRIVRKPDVLKSTYDGKLPITKNPSCST
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcgactccaagagtggtggtgaaggttgatctgaagaagaagccatgggag
caagaacagccactgcataacagatggcatcctgagataccatcagtagcacaagttaaa
gctggtgagtttttcagggtggagatgatcgattgcatggcaggtactgttaaggacaat
agctcttcagccgatatcaagcacgcagacctttctatgtctcattgcctaagtgggcct
attagggttgtggatgaggaaggtgttgcagcaaagccaggtgatcttcttgctgttgag
atatgcaacttaggtcctttaccaggacatgagtggggcttcacagcttcgtttgataga
gagaacggcggcggtttcttgactgatcatttcccttgtgccaccaaagctatttggtac
tttgaagggatctacgcctactctcctcaaattcctggagtacggtttccgggtttgacg
caccctggaatcattggcaccgcgccgtccatggaactactgagaatatggaatgaaagg
gagagacagatagaagaaaatggtgtcaagccgttttcactatgtgaggttgttcatcag
aggccactagcaaacctaccaaaggctaaaggatgcctcctagggcacattgacaaggaa
gcacctgaatgggaaaggattgcaaatgaagctgcaaggacattacctggaagagaaaac
ggaggaaactgtgatattaaaaacctaagcacaggctctaagatatatctacctgtgttt
gtggaaggtgctaatctaagcactggcgatatgcatttctctcaaggtgatggtgagatc
tccttctgtggagccattgagatgaatggattcctagaactcaagtgtgaaatcataagg
aatgggatgaaagagtaccttacgccaatgggacctactcctctccatgtcaacccaatc
tttgagataggaccagtggaaccgagattctcggagtggcttgtctttgagggtatcagt
gtcgatgagagcgggagacaacactatcttgatgcaacagtggcttacaaacgggcggtt
cttaacgcaatagattatctcaacaaatttggttactcaaaagaacaggcgtacctgttg
ctctcatgttgtccatgtgaaggaagaatctctgggattgttgattctcccaatgctgtt
gctacactagcaatacctattgccatctttgatcaggacattaggccaaagactcggagg
attccatcaggaccgcggatagtgaggaaaccggacgtactgaagagcacatatgatgga
aagcttccgattacaaagaatccaagctgctcaacatag

KEGG   Brassica napus (rape): 111214295Help
Entry
111214295         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC111214295
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00460  Cyanoamino acid metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00910  Nitrogen metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111214295
  09102 Energy metabolism
   00910 Nitrogen metabolism
    111214295
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    111214295
Enzymes [BR:bna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     111214295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 111214295
NCBI-ProteinID: XP_022572618
AA seq 452 aa AA seqDB search
MAPATPRVVVKVDLKKRPWEQEQPLHNRWHPEIQPVGEVKAGEFFRVEMVDWTGGAVKDD
DSAEDIKSLDLSTVHYLSGPIKVVDEDGVAAKPGDLLAVEICNLGPLPGDEWGFTASFDR
ENGGGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFPGLTHPGIIGTAPSKELLRIWNER
ERQLEESGLSSLTLCEVVHQRPLANLPIAKGCLLGNMEEGTPEWERIAKEAARTIPGREN
GGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEISFCGAIEMSGFLELKCEIIR
NGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDETGRQHYLDATVAYKRAV
LNAIDYLFKFGYSKEQVYLLLSCCPCEGRISGIVDSPNALATLAIPTSIFDQDIRPKTQK
VPAGPRIVRKPDVMKSTYDGKLETTSNPSSSS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgcaactccgagagtggtggtgaaagtggatttgaagaagaggccatgggag
caggaacagcctctgcataacagatggcatcctgagatacaaccagttggtgaggtcaag
gctggtgagttctttagagtggaaatggttgactggactggaggtgcagtcaaagatgat
gactctgctgaggatattaagagcctagacctctccactgttcattacctaagtggaccg
atcaaagttgttgatgaggatggtgttgcagcaaagccaggtgatcttcttgctgttgag
atatgcaacttaggtccattaccaggagatgagtggggcttcacagcttcgtttgataga
gaaaacggcggcggtttcttgactgatcatttcccttgtgccaccaaagctatttggtac
tttgaagggatctatgcctactctcctcagattcctggagtaaggtttccaggtttgaca
cacccaggcatcattggcactgcaccatcaaaagaacttttgagaatatggaatgaaagg
gagagacaattagaagaaagtggtctcagttccctaacactatgtgaggttgtgcatcaa
cgcccacttgcaaacctaccaatagctaaaggatgtctcctagggaacatggaagagggg
acaccggaatgggaaaggattgcaaaggaggctgcgagaacaatcccaggaagagaaaac
ggaggaaactgtgacataaagaacctaagcagaggctctaaaatatatcttccagtgttt
gtggaaggagctaacttaagcactggtgacatgcacttctctcaaggtgatggtgagatc
tctttctgcggagccattgagatgagtggattcctagaactcaagtgtgaaatcataaga
aacgggatgaaggagtaccttacaccaatgggacctacgcctctccacgtgaacccgata
ttcgagataggtccagtggaaccaagattctcagagtggctggtctttgagggtatcagt
gtagatgagacagggagacagcattaccttgatgcaacagttgcttacaagagggcggtt
ctcaatgctatagactatctgttcaagtttggttactcaaaagaacaggtatacctgtta
ctctcatgttgcccatgcgaagggagaatatctgggatagtcgattcaccaaacgcactt
gctacacttgcaatacccacatccatctttgatcaggatatacggccaaagactcaaaag
gttccagcaggacctcggatagtgagaaagccagacgttatgaagagtacatatgatggc
aaacttgaaactacaagtaatccaagttcttcgtcttaa

DBGET integrated database retrieval system