KEGG   Brassica napus (rape): 106389205Help
Entry
106389205         CDS       T04128                                 

Definition
(RefSeq) cytosolic isocitrate dehydrogenase [NADP]-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna04146  Peroxisome
Module
bna_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106389205
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106389205
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106389205
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     106389205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 106389205
NCBI-ProteinID: XP_013684865
UniProt: A0A078G4N9
AA seq 419 aa AA seqDB search
MAFEKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFVELDIKYFDLGLPHRDATDDKVTV
ESAEATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIICKNVP
KLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKLTLTFEGKDGKTETEVFTFTGEGGVAM
AMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEASWKSKYE
AAGIWYEHRLIDDMVAYALKSEGSYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRAKLDGNSKLLEFTEKLE
AACVGTVESGKMTKDLALIIHGAKLSRDTYLNTEEFIDAVADDLQTRLRRRNNLLNSCI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgaaaagatcaaggtggcaaatcccatcgtcgagatggatggtgatgaaatg
accagagttatctggaagtccatcaaggataagcttattaccccttttgtggagttggat
atcaagtactttgaccttggtcttccccaccgtgatgctactgatgacaaagttactgtt
gaaagtgctgaagccaccaagaagtataatgtggccatcaagtgtgccaccatcacgcca
gatgaaggccgtgtcacggaatttggcttgaagcagatgtggagaagtccaaatgggacc
atcaggaatattctgaatggaactgtatttagagaaccaattatctgcaaaaatgttccc
aagcttgtcccaggctggacaaagcccatctgcattggaaggcatgcttttggcgatcag
taccgtgccactgatgctgttatcaagggaccaggaaaactgactttgacttttgagggt
aaagacggaaaaactgaaactgaagtctttacatttaccggtgaaggaggtgtcgctatg
gccatgtacaacactgatgagtccatccgtgcttttgctgaggcatcgatgaacactgct
taccagaaaaagtggccactctatcttagcacaaagaacaccattcttaagaaatacgat
ggcagattcaaagacatcttccaagaagtgtatgaagccagctggaagtcaaagtatgag
gctgctggaatatggtatgagcaccgtctcattgacgatatggtggcttacgctcttaag
agcgaaggaagctatgtatgggcatgcaaaaactatgatggtgatgtccaaagtgatttc
ctggcacaagggttcgggtcacttggattgatgacatctgttctggtctgccctgatggg
aagactattgaagccgaagcagcacatggaactgttacccgtcactacagggttcaccag
aaaggtggcgagactagcacaaacagcatagcctccatctttgcttggactcgtggactt
gcacacagggctaagttagatggcaactcaaaactcttggagtttaccgagaagctcgaa
gctgcctgtgttggtacagtggagtctggaaagatgacaaaagatcttgcactcatcatt
cacggcgcaaagctctctagggacacttacctgaacacggaggagttcatcgatgcagtt
gcggatgatctccaaacaaggctaaggcggagaaataatctattaaattcctgtatctaa

DBGET integrated database retrieval system