KEGG   Brassica napus (rape): 106390282Help
Entry
106390282         CDS       T04128                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK6
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106390282
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106390282
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106390282
Protein kinases [BR:bna01001]
 Serine/threonine kinases: Other
  Wnk family
   106390282
Protein phosphatases and associated proteins [BR:bna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106390282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C PBC
Motif
Other DBs
NCBI-GeneID: 106390282
NCBI-ProteinID: XP_013686166
UniProt: A0A078JFQ9
AA seq 570 aa AA seqDB search
MEGAEDTAPIHEPPDPEVLEVDPTLRYIRYKEVIGKGAFKTVYKAFDEVDGIEVAWNQVR
IDDVLQSPNSLERLYSEVRLLKSLKHSNIIRFYNSWIDDKNKTVNIITELFTSGSLRHYR
KKHRKVNMKAVKCWARQILMGLRYLHTQVPPIIHRDLKCDNIFINGNHGEVKIGDLGLAT
VMEQAHAKSVIGTPEFMAPELYDEIYTELADIYSFGMCMLEMVTFEYPYCECRNSAQIYK
KVSSGIKPASLSRVQDPEVKQFIEKCLLPASERLSAKELLLDPFLQVNGLTMNNPLPLPD
IVMPKEGAFGERCLMSEGPPATRPSKPTSMDLDEDSNLPIVTFSDNSGSRCIEVRRAKRG
NFFVLKGEENDEQSVSLILRIVDENGRVRNIHFLFYQEGDTASKVSSEMVEQLELTDQNV
TFIAELIDILLVNMIPTWKTDVTVDHLIHSQLNQSSRSHQNEAKPQSQEESTFHDACESV
RHSWTSDCPRSEEEEKQFVDAIKGENGSDNQEAEEATEPVSLEEEERLRQELEEIEAKYQ
EEMKEIAKKREEAIMETKRKLSQKKVEQAG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgcggaggatactgctccaattcatgagcctcctgaccctgaagtcctcgaa
gttgatcctactcttcgttatattcggtataaagaggttatcggaaaaggcgctttcaag
acagtttacaaggctttcgatgaagttgatgggattgaagtcgcgtggaaccaagtccga
attgatgatgttttgcagtctccaaactccttggagaggctctactctgaagtgcgtctt
ttgaaatcgttgaagcacagtaacatcatcaggttctataactcttggatcgatgataag
aacaagactgttaacatcataactgagcttttcacttcagggagtctcaggcattaccgc
aagaaacacaggaaggtgaatatgaaggccgtcaagtgttgggcgagacagattttaatg
ggtttgagatatctccacactcaagtgccacccattatacacagagatctcaagtgcgat
aacatctttatcaatggcaaccatggagaagtcaaaataggagatcttggcctagccact
gtcatggagcaagctcatgccaagagtgtcattggaacccctgagtttatggcacctgag
ctttacgatgagatctacaccgagctagctgatatctattcatttgggatgtgtatgttg
gagatggtgacatttgaatacccatattgtgagtgcagaaactctgctcagatctacaag
aaggtctcatcggggataaaacctgcctcactctccagggttcaagacccagaagtaaag
cagttcattgagaagtgcttactccctgcatccgagaggctatcagccaaagagcttcta
ttggacccttttcttcaggtgaatggtttaacgatgaacaaccctctgccactacccgac
attgtaatgcctaaagaaggtgcgtttggagagcgttgccttatgtctgaaggccctcct
gcaacacggcctagtaaacccacgtctatggatctcgatgaagacagtaacctgccgatt
gttacttttagcgacaactcgggatccaggtgtatcgaggtcagacgcgcaaagagaggg
aatttctttgtcctcaagggtgaagaaaacgatgagcagtctgtctcgctgattcttcgt
atagtcgatgagaatggacgagtgaggaacattcatttcctgttctatcaagaaggtgac
actgcttccaaggtgtcgagtgagatggttgagcaactcgagttaactgaccagaacgtc
acgtttatagcggaactgatcgacatactgcttgtcaacatgatacccacatggaaaact
gatgtcacggtcgatcatctcatccattcgcagcttaatcagagctcgagaagtcatcag
aacgaagctaagccacagagtcaagaggagagcacttttcacgatgcttgcgagtcggtt
agacactcttggacttcggattgcccacgttcagaagaggaggaaaagcagtttgtcgat
gcaattaaaggagaaaacgggagtgacaaccaagaagcagaggaggcaaccgaaccggtg
agtttggaggaagaagagaggttaagacaggaactggaggagatagaggctaagtatcag
gaagagatgaaagagatagcaaagaaaagagaagaagcaataatggagacgaagagaaag
ttatctcagaagaaggtagaacaagctggttaa

DBGET integrated database retrieval system