KEGG   Brassica napus (rape): 106390738Help
Entry
106390738         CDS       T04128                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00071  Fatty acid degradation
bna00410  beta-Alanine metabolism
bna00592  alpha-Linolenic acid metabolism
bna00640  Propanoate metabolism
bna01040  Biosynthesis of unsaturated fatty acids
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01212  Fatty acid metabolism
bna04146  Peroxisome
Module
bna_M00087  beta-Oxidation
bna_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    106390738
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106390738
   00592 alpha-Linolenic acid metabolism
    106390738
   01040 Biosynthesis of unsaturated fatty acids
    106390738
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106390738
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106390738
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106390738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 106390738
NCBI-ProteinID: XP_013686715
AA seq 439 aa AA seqDB search
MTVLSSADRDNAEKKVKSSYFDLPAMEISVAFPQATPASKFPPCTSDYYHFDDLLTPEEQ
AVRKRVREFMEKEVAPIMTEYWEKAEFPFHIIPKFGALGVAGGSIKGYGCPGLSITANAI
ATAEISRVDASCGTFNLVHTSLGMLTIALCGSEAQKQKYLPDLAQMKTVTCWALTEPDNG
SDASALTTTATKVEGGWVLEGQKRWIGNSTFADLLVIIARNTTTNQVNGFLVQKDAPGLT
VTKIPNKIGLRIVQNGDILLKNVFVPDEERLPGVNSFQDTSKVLAVSRVMVAWQPIGISM
GVYDMCHRYLMERKQFGAPLAAFQLNQQKLVKMLGNVQAMFMMGWRLCKLYESGQMTPGQ
ASLGKAWISSKARETASLGRELLGGNGVVGDFLVAKAFGDLEPIFTYEGTYDINTLVTGR
EVTGIASFKPPASRGRSRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgctctcatctgcagatcgtgataatgctgagaagaaggtgaagagttcgtat
tttgatttgccagctatggagatatctgtagcgtttcctcaagcaacaccagcctctaag
ttcccaccgtgcacttcagactattaccatttcgatgatctattgactccggaggaacag
gctgttcggaagagggtgagagagttcatggagaaagaagttgctcccataatgactgag
tactgggagaaagcagagtttcctttccatatcattccaaagtttggagctttaggtgtt
gctggtggctccatcaagggttatggatgtcctggcctctccatcacagccaatgctatt
gctacagcggaaatatctagagttgatgcaagctgtgggacttttaatttggtgcatacc
tctttgggcatgctcactattgctctttgtggatcagaagcacagaagcagaaatatttg
cctgatttggctcagatgaaaactgtgacttgttgggctttgacagaacctgacaatgga
agcgatgcaagtgctctgacaacaactgccacaaaggtggaaggaggttgggtgcttgag
ggacaaaagcgttggattggaaacagcacctttgcagatcttttggtcatcattgctagg
aatacgacaacgaaccaagtcaacggattcttagtccagaaagatgcgcctggcctaacg
gttactaaaatcccgaataaaataggtttacgtattgttcagaatggagacattctacta
aagaatgtctttgttccggatgaggagcggttacctggggtaaattcatttcaggacaca
agcaaggtcctggctgtctcacgtgtaatggtggcctggcaaccaattggtatatcaatg
ggagtctacgatatgtgtcacaggtatctaatggagaggaaacaatttggagcaccgttg
gctgctttccagttaaaccaacagaagcttgtgaagatgctgggcaatgttcaagccatg
tttatgatgggttggcgcctctgcaagctatatgagtcgggtcagatgactccaggtcaa
gccagtttaggaaaggcatggatttcatccaaggcaagggaaactgcttcgctaggtcgg
gaactacttggtgggaatggagttgtaggggattttctggtggcaaaggctttcggtgac
cttgaacccatttttacatacgaagggacgtacgacataaacaccttagtgacggggagg
gaagttaccgggattgcgagtttcaaacccccagcttcacggggccgtagccgtctttaa

DBGET integrated database retrieval system