KEGG   Brassica napus (rape): 106391426Help
Entry
106391426         CDS       T04128                                 

Definition
(RefSeq) probable sucrose-phosphatase 2
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
bna  Brassica napus (rape)
Pathway
bna00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106391426
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     106391426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S6PP S6PP_C Hydrolase_3 PMM Trehalose_PPase PriA_3primeBD
Motif
Other DBs
NCBI-GeneID: 106391426
NCBI-ProteinID: XP_013687519
AA seq 422 aa AA seqDB search
MERLTSPARLMIVSDLDHTMVDHHDPENLALLRFNSLWEHAYRHDSLLVFSTGRSPTLYK
ELRKEKPLLTPDVTIMSVGTEITYGNSMVPDLGWVDDLNHKWDLGVVKEETGKFSELTLQ
AETEQRPHKVSFYVDKSKAEEVIKELSQRLEKRGLDVKIIYSGGMDLDILPQGAGKGQAL
AYLLKKLKSEGKLPVNTLACGDSGNDAELFSIPDVYGVMVSNAQEELLKWHAENAKDNPK
VIHAKERCAGGIIQAIGEFKLGPNLSPRDVSDFLECKVENPNPGHDVVKFFLFYERWRRG
EVENSEAYAASLKASCQPGGVFVHPSGAEKSLVDTIGELRKHHGDKQGKKFRVWVDQVLA
TETAPGTWMVKLDKWEQSGDERIGCTTTVKFTAKEGEGLVWEHVEQTWSEESKLKDDSSW
II
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggagaggctaacatctcctgctcgtctcatgatagtctcggatcttgatcataccatg
gttgatcatcacgatcctgagaacctcgctttgctcagattcaactcgctatgggaacac
gcttatcgccatgactctcttctcgtcttctcaaccggaagatcaccgactctgtacaaa
gaactgagaaaggagaagcctttgctgacccctgacgttacaatcatgtctgtagggact
gagattacttatggtaactccatggttcctgatcttggttgggttgatgacttgaatcat
aaatgggatttgggggttgttaaagaagagaccggcaagttctctgagttaactcttcag
gcagagactgagcagaggccacacaaggttagcttttacgttgacaagagtaaggctgag
gaagtgatcaaggagctgtcacagcggttggagaaacgtgggttggatgtcaaaataatc
tacagtggtggaatggatttagacatcttaccacaaggtgctggaaagggacaagcgctt
gcttatctcctcaagaagctcaagagcgaaggaaagctccctgtcaacactcttgcctgt
ggagactccgggaacgatgctgaactctttagcattcccgatgtttacggcgtcatggta
agcaatgcacaagaagagctcttgaagtggcacgccgagaacgccaaagacaatccaaag
gtgatccatgccaaggagaggtgtgcaggtgggattatacaagccattggcgagttcaag
cttggtccaaacctttctccgagagatgtctctgacttcttggagtgcaaggtggagaat
ccgaaccctggtcatgacgttgtgaagtttttcttgttttatgagaggtggagacgcggt
gaggttgagaactcggaggcgtatgcggcgagcctcaaagcttcatgtcaacctggtggt
gtgtttgtgcatccatctggtgctgagaagtctctggtagatactattggtgagctaagg
aagcaccatggagacaaacaagggaagaagtttcgggtttgggtagatcaagtcttggct
acagagactgctcctgggacatggatggtaaagcttgataagtgggagcagagtggtgat
gaacgcataggctgcaccacgactgtcaaattcacagcaaaggaaggggaagggttggtg
tgggaacatgtagagcaaacatggtcggaggaatcaaagttgaaggatgatagcagctgg
atcatctga

DBGET integrated database retrieval system