KEGG   Brassica napus (rape): 106392039Help
Entry
106392039         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106392039
   00520 Amino sugar and nucleotide sugar metabolism
    106392039
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106392039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106392039
NCBI-ProteinID: XP_013688271
UniProt: A0A078GQ79
AA seq 246 aa AA seqDB search
MAAKKPGVIVLFDVDDTLTAPRKEATQEMLDFIQKLRKVVTIGLVGGSDLDKISEQLGKT
VTNDFDYCFTENGLVAHKDGKSIGIQSMKLFLGEDKLKELINFTLHYIADLDIPIKRGTF
IEFRNGMINVSPIGRNCSQEERDEFERYDKVHNIRPKMVAELRVRFAHLNLTFSIGGQIS
FDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMAQC
KALFLY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagaagccaggagtgatcgttttgttcgacgtggacgatactcttacagct
ccaaggaaggaagctactcaagaaatgctcgattttatccaaaaattacgcaaggttgtc
actattggactcgtcggtggatctgatctagacaagatatctgagcaacttggcaaaaca
gtcactaacgactttgattattgtttcactgagaatggtcttgttgcacataaagatggc
aaatccattggaatccagagcatgaagctgttccttggagaagataagctcaaggagtta
atcaatttcacgctgcactacattgcagacttggatattccaatcaagaggggaacattt
atagagttccgaaatggaatgatcaatgtgtcacctattggtcgcaactgcagccaggaa
gaaagagacgagttcgagagatatgataaggttcataacattcgaccaaagatggtggct
gaacttcgtgtgcggtttgcccatcttaaccttactttctctattggaggacagattagc
ttcgacgtcttccctaaaggttgggacaagacttactgcttgcaataccttgaggacttc
aacgaaatccatttcttcggtgacaaaacctatgagggtggaaatgattatgaaatatat
gaatcaccaaaaacaattggccattcagtaacgagtccagatgacacaatggcacaatgc
aaggctctgttcttgtattga

KEGG   Brassica napus (rape): 106429590Help
Entry
106429590         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase-like
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106429590
   00520 Amino sugar and nucleotide sugar metabolism
    106429590
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106429590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106429590
NCBI-ProteinID: XP_013725790
AA seq 328 aa AA seqDB search
MLPFKFNHTIRVLVYREIMILTRHDYLINQSHISRTKREDHILSDTLSLKIRSVHSRLYC
YSHLLPPLSSSSSSTSKSLHPSMAAKKPGVIALFDVDGTLTAPRKEATPELLEFIRELRK
VVTVGVVGGSDLSKISEQLGKTVTTDYDYCFSENGLAAHKDGEPIGIQSLKLYLGEDKLK
ELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKM
VAELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYE
IYESPKTIGHSVTSPDDTMAKCKALFMS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgtttaaattcaaccatactataagagtattagtatatagagaaataatgata
ttaacgcgtcacgattatttaatcaaccaatcacatatctctaggacaaaaagagaggac
catatattaagcgacacactttcgttaaagattagatcggtccactctcgtttatattgt
tattcacatcttcttccgccattatcatcatcatcttcttccacttccaaatctcttcat
ccttcaatggcggccaagaagccaggagtgatcgctttgttcgacgtcgacggtactctc
actgctccgaggaaggaagctactcctgaattgctcgagttcatccgagaattgcgcaag
gtggttactgttggagtcgtcggtggatctgatctaagcaagatatctgagcagcttggc
aaaacagtcaccaccgactatgattattgtttctctgagaatggtcttgctgcccataaa
gatggggagcccattggaatccagagcctgaagctgtaccttggcgaagacaaactcaag
gagctgataaatttcacgctgcactacattgcagacttggatattccaatcaaaagggga
acatttatagaattccgaaatggaatgctcaatgtgtcaccgattggtcgcaactgcagc
caagaagaaagagacgagttcgagagatatgataaggttcaaaacattagaccaaagatg
gtggctgaacttcgtgagcggtttgcacatcttaaccttactttctcaattggaggacag
atcagcttcgatgtcttccctaaaggttgggacaagacttactgcttgcagtaccttgaa
gacttcaatgaaattcatttcttcggtgacaaaacctatgagggtggaaatgattatgaa
atttatgaatcaccaaaaacaattggccattcagttactagtccagatgatacaatggct
aaatgcaaagctctgttcatgtcttga

KEGG   Brassica napus (rape): 106438263Help
Entry
106438263         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase isoform X2
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106438263
   00520 Amino sugar and nucleotide sugar metabolism
    106438263
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106438263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106438263
NCBI-ProteinID: XP_013734824
AA seq 246 aa AA seqDB search
MAVKKPGVIALFDVDGTLTAPRKEATPELLEFIRELRKVVTVGVVGGSDLSKISEQLGKT
VTTDYDYCFSENGLVAHKDGKPIGIQSLKLYLGEDKLKELINFTLHYIADLDIPIKRGTF
IEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQIS
FDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMAKC
KALFMS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaaaaagcccggagtgatcgcgttgttcgacgtcgacggtactctcactgct
ccgaggaaggaagctactccagaattgctcgagttcatccgagaattgcgcaaggtggtt
actgttggagtcgtcggtggatctgatctaagcaagatatctgagcagcttggcaaaaca
gtcaccacagactatgattattgtttctctgagaatggtcttgttgcccataaagatggg
aagcccattggaatccagagcctgaagctgtaccttggtgaagataaactcaaggagttg
ataaatttcacgctgcactacattgcagacttggatattccaatcaaaaggggaacattt
atagagttccgaaatggaatgctcaatgtgtcaccgattggtcgcaactgcagccaagaa
gaaagagacgagttcgagagatatgataaggttcaaaacattagaccaaagatggtggct
gaacttcgtgagcggtttgcgcatctcaaccttactttctctattggaggacagattagc
ttcgacgtcttccctaaaggttgggacaagacttactgcttgcagtaccttgaagacttc
aatgaaattcatttcttcggtgacaaaacctatgagggtggaaacgattatgaaatttat
gaatcaccaaaaacaattggccattcagttactagtccagatgatacaatggctaaatgc
aaagctctgttcatgtcttga

KEGG   Brassica napus (rape): 106450880Help
Entry
106450880         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106450880
   00520 Amino sugar and nucleotide sugar metabolism
    106450880
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106450880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106450880
NCBI-ProteinID: XP_013748122
AA seq 246 aa AA seqDB search
MAAKKPGVIALFDVDGTLTAPRKEATPELLHFIKELRKVVTVGVVGGSDLTKISEQLGKT
VTTDYDYCFSENGLVAHKDGKPIGIQSLKLHLGEDKLKELIKFTLHYIADLDIPIKRGTF
IEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQIS
FDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMAKC
KALFMS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagaagccaggagtgatcgctttgttcgacgtcgacggtactctcacagct
ccaaggaaggaagctactccagaactgctccatttcatcaaagaattgcgcaaggttgtc
actgttggagtcgtcggtggatctgatctaaccaagatatctgagcagcttggcaaaaca
gttactacggactatgattattgtttctctgagaatggtcttgttgctcacaaagatggg
aaacccattggaatccagagcctgaagctgcaccttggagaagataaactcaaggagttg
ataaaattcacgctgcactacattgcagacttggatattccaatcaaaaggggaacattt
atagagttccgaaatggaatgctcaatgtgtcacctattggtcgcaactgcagccaagaa
gaaagagacgaattcgagagatatgataaggtacaaaacattcgaccaaagatggtggct
gaacttcgtgagcggtttgcgcatcttaaccttactttctccattggaggacagattagc
ttcgatgtcttccctaaaggttgggataagacttactgcttgcaataccttgaagacttc
aatgaaatccatttcttcggtgacaaaacctatgagggtggaaacgattatgaaatctat
gaatcaccaaaaactataggccattcagttacgagtccagatgacacaatggcgaaatgc
aaggctctattcatgtcttga

KEGG   Brassica napus (rape): 106450944Help
Entry
106450944         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106450944
   00520 Amino sugar and nucleotide sugar metabolism
    106450944
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106450944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106450944
NCBI-ProteinID: XP_013748225
UniProt: A0A078FWU2
AA seq 246 aa AA seqDB search
MAAKKPGVIALFDVDGTLTAPRKEATPELLHFIKELRKVVTVGVVGGSDLTKISEQLGKT
VTTDYDYCFSENGLVAHKDGKTIGIQSLKLHLGEDKLKELIKFTLHYIADLDIPIKRGTF
IEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQIS
FDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMAKC
KALFMS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagaagccaggagtgatcgctttgttcgacgtcgacggtactctcacagct
ccaaggaaggaagctactccagaactgctccatttcatcaaagaattgcgcaaggttgtc
actgttggagtcgtcggtggatctgatctaaccaagatatctgagcagcttggcaaaaca
gttactactgactatgattattgtttctctgagaatggtcttgttgctcacaaagatggg
aaaaccattggaatccagagcctgaagctgcaccttggagaagataaactcaaggagttg
ataaaattcacgctgcactacattgcagacttggatattccaatcaaaaggggaacattt
atagagttccggaatggaatgctcaatgtgtcacctattggtcgcaactgcagccaagaa
gaaagagacgaattcgagagatatgataaggtacaaaacatacgaccaaagatggtggct
gaacttcgcgagcggtttgcgcatcttaaccttactttctctattggaggacagattagc
ttcgatgtcttccctaaaggttgggataagacttactgcttgcaataccttgaagacttc
aatgagatccattttttcggtgacaaaacctatgagggtggaaacgattatgaaatttat
gaatcaccaaaaacaattggccattcagttacgagtccagatgacacaatggcgaaatgc
aaggctctgttcatgtcttga

KEGG   Brassica napus (rape): 106452175Help
Entry
106452175         CDS       T04128                                 

Definition
(RefSeq) phosphomannomutase
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106452175
   00520 Amino sugar and nucleotide sugar metabolism
    106452175
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     106452175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 S6PP
Motif
Other DBs
NCBI-GeneID: 106452175
NCBI-ProteinID: XP_013749665
UniProt: A0A078HFC3
AA seq 246 aa AA seqDB search
MAAKKAGVIALFDVDDTLTAPRKEATQEMLHFIQKLRKVVTIGLVGGSDLNKISEQLGKT
VTNDFDYCFTENGLVAHKDGKSIGIQSMKLFLGEDKLKELINFTLHYIADLDIPIKRGTF
IEFRNGMINVSPIGRNCSQEERDEFERYDKVHNIRPKMVAELRVRFAHLNLTFSIGGQIS
FDVFPKGWDKTYCLQYLEDFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMAQC
KALFIS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagaaggcaggagtgatcgcattgttcgacgtggacgatactcttacagct
ccaaggaaggaagctactcaagaaatgctccattttatccaaaaattacgcaaggtagtc
actataggactcgtcggtggatctgatctaaacaagatatctgagcaacttggcaaaaca
gtcactaacgactttgattattgtttcactgagaatggtcttgttgcacataaagatggt
aaatccattggaatccagagcatgaagctgttccttggagaagataagctcaaggagtta
atcaatttcacgctgcactacattgcagacttggatattccaatcaagaggggaacattt
atagagttccgaaatggaatgatcaatgtgtcaccgattggtcgcaactgcagccaggag
gaaagagacgagttcgagagatatgataaggttcataacattcgaccaaagatggtggct
gaacttcgtgtgcggtttgcacatcttaaccttactttctctattggaggacagattagc
ttcgatgtcttccctaaaggttgggacaagacttactgcttgcaataccttgaagacttc
aacgaaatccatttcttcggtgacaaaacctacgagggtggaaatgattatgaaatctat
gaatcaccaaaaacaataggccattcagtaacgagtccagatgatacaatggcacaatgc
aaggctctgttcatctcttga

DBGET integrated database retrieval system