KEGG   Brassica napus (rape): 106393361Help
Entry
106393361         CDS       T04128                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
bna  Brassica napus (rape)
Pathway
bna00130  Ubiquinone and other terpenoid-quinone biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    106393361
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     106393361
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     106393361
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     106393361
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     106393361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Hydrolase_4 Ndr BAAT_C Abhydrolase_2 Thioesterase Abhydrolase_3 DLH Lipase Esterase DUF2974 Chlorophyllase TPP_enzyme_M Lipase_3
Motif
Other DBs
NCBI-GeneID: 106393361
NCBI-ProteinID: XP_013689518
AA seq 1710 aa AA seqDB search
MASPPCYSFLLLSNPPFLPSLIPRYASRYSFTRRTQRFSSFASSLRGIGRNIEVAQGAQF
DELVLSRDDVSEDDELTVQVCVTRTLPPALTLEVGLERVMEAVDELKSNPPKSSSGVLRF
QVAVPPRAKALFWFCSQPVSSGVFPVFFLSKDTVEPSYKSLYVKEPHGVFGIGDALSFLH
HSKGHSSIKTFLSDESAMVTAYGFPDIDFNGNSSVYSKDGSSYFFVPQVELDEHEEVSIL
AVTLAWNDSLSYSFEQAISSYEKSIFQVSCHVCPNLEEHWFKNLKSSLAKLDVKEIHPIK
MEHMEYLTFSGRDQGDAKELKNIQPLCQFHCKLSPDVVFSNNMLNQEAEVSNSLKDQANI
NAVWASAIIEECTRLGLTYFCVAPGSRSSHLAIAAANHPLTTCLACYDERSLAFHAIGYA
KGSLKPAVIITSSGTAVSNLLPAVVEASEDFLPLLLLTADRPPELQGVGANQAINQINHF
GSFVRFFFNLPPPTDLIPVRMVLTTIDSALHWATGSACGPVHMNCPFRDPLDGSPTNWSF
NCLNGLDMWMSNSEPFTKYFQVQSLKSNGETTGQITEVLQVIKEAKKGLLLIGAIHTEDE
IWASLLLAKELMWPVVADVLSGVRLRKLSKPFLEKWTPIFVDHLDHALLSDSVKNLIEFD
VVIQVGSRITSKRVSQVLEKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFADCVLKS
RFPWRRSKLHGHLHALDGAIAREMSFQLSAECSLTEPYVAHMLSKALTSKSALFIGNSMP
IRDVDMYGCSSGNYSHVVDMMLSAELPSQWIQVTGNRGASGIDGLLSSATGFAVGCKKRV
VCVVGDVSFLHDTNGLAILKQRTARKAMTVLVINNRGGGIFRLLPIAKRTEPSVLNQYFY
TSHDISIENLCLAHGVKYVHVGTKRELEETLLEPSVEEMDCIVEVESSIDANAIVHSTLE
SFARQAANNSLGIISASSVLHPMIDSVLLFQVSGIQYSRYRVGLCDRPTIYSGESSQFHR
EGFILSLTLEDGSIGCGEVAPLDSSRENLMDVEGQLQLILHLMKGAKVSHMLPLLNGSFS
SWIWSELGITASSVFPSVRCGLEMALLNAMAVKHDSGLMGILHCQKEENGSAQPHSVPIC
ALLDSEGTPSEVAYVARKLVEEGFSAIKLKVARRVNSVQDALVLQEVRRLVGDQIELRVD
ANCRWTFEEAITFGLLVKKCNLQYIEEPVQNKDDLIRFCEESGLPVALDETLDDFKECPL
RMLAKYTHPGVVAVVIKPSVVGGFEIAALIARWAQQHGKMAVISAAYESGLGLSAYILFA
SYLETENVKTFRERKQGMAPLVAHGLGTYKWLNEDVMMNSLGISRSPYSGFIEGSVADAS
KNLKDVNINNDVIVRTSIGVLVRRCELRVDVGGFSHFVRIHEVGQNVEGSVVMFLHGFLG
TGEEWIPIMKGISGSARCISVDIPGHGSSRVQSNASETPTFSMEMIAEALYKLIEQITPG
KVTIVGYSMGARIALYMALRFSNKIEGAVVVSGSPGIKDPVARKVRSATDDSKARMMVDH
GLEIFVENWYNGGLWKSFRSHPHFRKIVASRLVHDDVLSVAKCLSDLSTGRQPSLWEELA
DCDTNVSLVFGEKDVKFKKIASRMYLEMSKSKKSEIHIIETVEIPEAGHAVHLESPLHLI
LALRKFLTRVRKNSAETELSQKLLLALKET
NT seq 5133 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcctccatgctactcctttctcctcctctcgaatcctccgtttctaccttct
ctgattcctcgctacgcttctagatactccttcacacggcgaacacaacgcttctcctcc
ttcgccagctctcttcgtggaatcggaagaaacatcgaggtcgctcaaggagctcaattc
gatgagctggttctgagtagagacgatgtgagtgaggatgatgagttaacggtacaagtg
tgtgtgactcgtacgttgcctccagctttgactcttgaggttggacttgagagagtcatg
gaagctgtggacgaactcaagtctaatcctcctaagtcctctagtggcgtcttgcgattt
caagtggctgtgcctccaagggccaaagctttgttctggttctgctctcaacctgtgtct
tccggtgtattccctgtgtttttcctctccaaggatactgtggagccgtcttataagtcg
ctctatgtaaaggaacctcatggggtttttggaattggggacgcactctctttccttcat
cactccaagggtcatagcagcataaaaacattcctctcagatgaatcagctatggtgacg
gcctatggttttccagatattgatttcaacggaaactctagtgtatatagcaaggatggc
tcttcttacttcttcgttcctcaggtcgagttagatgagcacgaggaggtctccatatta
gcagttaccctggcatggaatgattctctatcctatagttttgagcaagcaattagttca
tatgagaaatcaatttttcaggtttcttgtcatgtctgccccaatttagaggagcattgg
tttaaaaatctaaaaagttctcttgcaaagttggatgtaaaagagattcatccaattaag
atggagcatatggagtatttaacattttctgggagagatcagggtgacgccaaggaactg
aaaaatatacaaccattatgtcagttccactgcaagctttcacctgacgttgttttctca
aacaacatgctgaatcaggaggctgaagtgagcaactccttgaaagatcaggctaatatc
aatgctgtatgggcatcagctataattgaagaatgcactcgtcttggtttgacgtacttt
tgtgtagctcctggatcaagatcctcccatcttgcaattgctgctgccaaccaccccctt
acaacgtgtcttgcatgctatgacgaacgatctcttgcatttcacgctattgggtatgct
aaaggatcccttaaaccggctgtcattataacatcatcaggaaccgccgtttcaaatctt
cttccagcggtggttgaagccagtgaggatttcttgcctctgctactacttactgcagat
cgtcctcctgaacttcagggagtgggcgcaaatcaagctataaatcaaataaaccacttt
ggttcgtttgtcagattcttcttcaatcttcctcctccaactgatcttataccagtccgg
atggtccttactactatagactctgctctacattgggcaacaggttctgcttgtggacca
gtacatatgaattgtccttttagagacccacttgacggtagtccaacaaattggtcattc
aactgcttaaatggattagacatgtggatgtccaattctgaaccattcacaaaatatttt
caagttcaaagcctcaagagcaatggtgaaacaactggccaaattactgaggtcttacaa
gtaatcaaagaggctaagaagggtcttcttcttatcggtgcaatccatacggaggatgaa
atttgggcttctcttctgttggctaaagaactgatgtggccggttgttgcagatgtcttg
tctggtgtacggctgcgcaagctgtctaagccttttcttgagaagtggacccctattttt
gttgatcatcttgatcatgccctgctttcagattctgttaagaatttgattgagtttgat
gttgttatccaggttggaagtcggataacaagtaaaagagtttctcaggtgctagagaaa
tgctttccatttgcatacattttggttgataagcatccatgccgacatgatccatcacac
ttggtcactcacagggtccaaagcaatatcgttcagtttgctgattgcgtgcttaaatct
cgatttccatggaggagaagcaaattgcatggtcatttacatgcattggatggcgcaatt
gcccgcgaaatgtcatttcaattatctgctgagtgctccctgaccgaaccttatgtggca
catatgctttccaaagcattgacttccaaatctgctcttttcatcggaaatagtatgcca
ataagggatgtggatatgtatggatgtagttcgggaaattattcgcacgtggtagatatg
atgttaagtgcagaactgccatctcaatggatacaagtaactggaaatagaggagctagt
ggcattgatggcttgctcagctccgccactggctttgctgtagggtgcaagaagagagtt
gtctgtgtggtgggagacgtctctttccttcatgatacaaatggattggcgattttgaag
cagaggactgcgaggaaagcaatgacagttctcgtgataaataaccgtggaggtggaatc
ttccgacttcttcctatagcaaagagaacagagcctagcgtgttgaatcaatatttctat
acatcacatgacatttccatagaaaacttgtgtttggcacatggtgtgaagtatgtacac
gttgggacaaaaagggaacttgaggaaactctattggaacccagcgttgaagagatggat
tgcattgtggaggttgaaagctctattgatgctaacgcgatcgttcatagtactttggag
agttttgcacgccaagctgcaaataattccttgggcattatctcggccagttctgttctt
catccaatgatcgacagtgtacttcttttccaagtctctggaatacaatattcgcggtac
agagtcggactgtgcgacagacctaccatatattctggtgaatcctctcaattccataga
gaagggttcatactctcccttactttggaggatggaagcattggctgcggagaggttgca
cctttggacagtagtagggagaacttaatggatgttgaggggcagctacagttgattctt
caccttatgaaaggagctaaagtcagtcacatgcttcctttgttaaatggctcgttttct
tcctggatttggagtgaacttggaatcactgcatcatcagttttcccaagtgtcagatgt
ggtctggaaatggctcttctgaatgcaatggcagtaaaacatgattctggtttaatgggg
atacttcattgtcagaaagaagaaaatggttctgctcagccacactctgttccaatatgt
gcccttcttgattctgaaggtactccatcagaggtcgcatacgttgctagaaaacttgtt
gaagaagggttcagtgctattaaacttaaagttgctcgtcgagtgaactccgttcaagat
gctttagttctgcaagaagtaaggagactagttggcgatcaaattgaactccgtgtagat
gctaattgtcgctggacttttgaagaggctataacgtttggtttattggtgaaaaaatgc
aatctacagtatattgaggaacctgtccagaataaagacgatcttataaggttttgtgaa
gaaagtggattaccagtagcacttgatgagactcttgatgattttaaggaatgtcccttg
cgcatgcttgccaaatatacccatcctggagtagttgctgttgttattaaaccaagtgtt
gtcggagggtttgagattgcagcactgattgctcgctgggcacagcagcatggaaagatg
gctgttataagtgccgcatatgaaagtggcctaggtttgtcagcatatattttgtttgca
tcatatttggagacggagaacgtcaaaacatttagagagagaaagcaaggaatggcccct
cttgtggctcatggtcttggaacctacaaatggcttaatgaagacgtaatgatgaatagt
ttagggatatctcgtagtccgtacagtggatttatcgaaggatctgttgctgatgctagc
aaaaatctaaaggatgttaacataaacaacgatgttattgtaagaaccagcataggagtt
ctcgtccggaggtgtgaactgagggtggacgtaggtggtttctctcattttgtaagaatc
cacgaggttgggcagaatgtagaaggaagtgtagttatgtttcttcatgggtttcttgga
actggtgaagaatggatccccatcatgaagggtatctcgggatctgcaagatgcatttca
gttgatatccctggtcatggaagctcaagggtacagagtaatgctagtgagaccccaact
ttctcaatggagatgatagcggaagcactgtataaattgattgagcaaattactcctggc
aaagttaccatagttggatattccatgggagcaagaatagcactgtacatggctttgaga
tttagcaacaagatcgaaggcgctgttgtggtatcggggagccccgggatcaaggatcca
gtggcaaggaaagttcgaagtgcaacagatgattctaaagcacgaatgatggttgaccat
ggactagaaatctttgtggagaactggtacaatggaggcttgtggaaaagtttcagaagt
cacccccatttcagaaaaatagttgcaagccgcttggtacatgatgatgtccttagtgtt
gcaaagtgcctctcagatctgagcactgggagacagccgtcattgtgggaagagttggct
gattgtgatacaaatgtctcacttgtcttcggagagaaagatgtaaaattcaagaaaatt
gctagtaggatgtaccttgagatgagtaaaagcaagaagagcgaaatccatatcattgag
acggttgaaatcccagaagctggccacgctgttcatctggagagccctctccacttgatc
ctcgctcttagaaagttcttaacaagagtgcgcaaaaactctgcagagacagagctttcg
cagaagctcttgttagcacttaaagaaacataa

DBGET integrated database retrieval system