KEGG   Brassica napus (rape): 106394340Help
Entry
106394340         CDS       T04128                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 4-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    106394340
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     106394340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase
Motif
Other DBs
NCBI-GeneID: 106394340
NCBI-ProteinID: XP_022556135
AA seq 170 aa AA seqDB search
MDYHRGANVEVRIARIFNTYWPRMCIDDGRVVSNFVAQALRKAPLTVYGDGKQTRSFQFV
SDLVEGLMRLMEGEHVGPFNLGNPGESTMLELAKVVQETIDPNAKIEFRPNTEVDPHKRK
PDITKAKELLGWEPKVALRQGLPLMVKDFRQRVFGDQKQETITTSSSSTE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggattaccacagaggcgccaatgttgaggttaggatagctcggatcttcaatacttac
tggcctaggatgtgtattgatgacggtcgtgtcgttagcaacttcgttgcccaggcatta
agaaaagcgccattgactgtttatggcgacggtaagcagacacggagcttccagtttgtc
tctgatctggtggagggtctgatgaggttgatggaaggagaacatgttggcccatttaac
cttggcaaccctggtgaatccaccatgctcgagctcgctaaggtggttcaagagacgatc
gacccgaacgcaaagatagagtttagaccaaacacagaggtcgacccacacaagaggaaa
ccagacatcacaaaggccaaagagcttcttggttgggaaccaaaggtcgctctccgccaa
gggctccctcttatggtcaaagatttccgtcagcgtgtctttggcgaccaaaagcaggag
accatcaccacttcttcttcatcaacagaataa

DBGET integrated database retrieval system