KEGG   Brassica napus (rape): 106396409Help
Entry
106396409         CDS       T04128                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bna  Brassica napus (rape)
Pathway
bna00450  Selenocompound metabolism
bna00970  Aminoacyl-tRNA biosynthesis
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106396409
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106396409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106396409
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bna03016]
    106396409
Enzymes [BR:bna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106396409
Amino acid related enzymes [BR:bna01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106396409
Transfer RNA biogenesis [BR:bna03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106396409
 Prokaryotic type
   Other AARSs
    106396409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Flavodoxin_2 UPA
Motif
Other DBs
NCBI-GeneID: 106396409
NCBI-ProteinID: XP_013692246
AA seq 609 aa AA seqDB search
MAARLNTSLQNTLSLLNPFNTLLTKKPFASRNSFRFSKKLPSSPRRALYCTSTLESHDNA
ETFVLTTPLYYVNAPPHMGSAYTTIAADSIARFQRLLGKKVIFITGTDEHGEKIATSAAA
NGRNPSEHCDLISQSYRTLWKELDIAYDKFVRTTDPKHEAIVKEFYDRVFANGDIYRADY
EGLYCVNCEEYKDEKELLENNCCPVHQMPCVARKEDNYFFALSKYQKPLEEVLSQNPRFV
QPSYRVNEVQTWIKSGLRDFSISRALVDWGIPVPNDDKQTIYVWFDALLGYISALTEDNE
QQNLDTAVSLGWPASLHLIGKDILRFHAVYWPAMLMSAGLNLPKMVFGHGFLTKDGMKMG
KSLGNTLEPFELVQKFGPDAVRYFFIREVEFGNDGDYSEDRFIKIVNAHLANTIGNLLNR
TLGLLKKNCESTLVVDSTIAAEGVPLKDTVEKLVEKARTNYESLSLSTACEAVLEIGNAG
NSYMDQRAPWMLFKQGGVSAEAAAKDLVIILEVMRIIAVALSPIAPCLSLKIYSQLGFSV
DEFNSITWDDTKWGELRVGQVMAQASPVFVRIELDAAEKDEEEKKPKDSKKKGKAKVKAE
QQPQTIAEA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaggttaaacacttcgcttcaaaacaccctctctttgttaaacccatttaat
actctcctcactaagaaaccattcgcttcgagaaacagcttcagattctccaaaaagctc
ccttcttccccgaggagagctctctactgtacttccaccctcgaaagccatgacaacgcc
gagactttcgtcctcaccacccctctttattacgtaaatgcccctccccacatgggcagt
gcctacaccaccatcgccgccgattcaatcgcccgtttccagaggctgcttggcaagaag
gttatctttatcaccggaacagatgagcatggtgagaagatagctacctcagcagctgct
aacggacgcaacccttccgagcattgtgatctcatttctcagtcttatcgaactctttgg
aaagaactcgatatagcttatgacaagttcgtcagaaccactgatcctaagcatgaagct
atcgtgaaagagttctatgatcgagttttcgcgaacggggatatatacagagctgattat
gaaggtctttactgtgttaactgtgaggaatataaggatgagaaagagctgcttgaaaac
aattgttgccctgttcatcaaatgccatgtgttgccaggaaagaagataactacttcttt
gctctatcgaagtatcagaaacctcttgaagaagttttgtctcagaatcctcgtttcgtg
cagccttcctaccgtgtaaacgaggtgcaaacatggataaagagtggcttaagggatttt
tcaatttctcgagcattagtagattgggggattcctgttcctaatgacgacaagcaaacc
atatatgtttggtttgacgctctactaggttacatatcagctctaacagaggacaatgag
caacaaaatctagacactgccgtttcattaggctggcctgcttcattgcatttgattggg
aaggatattctaaggtttcacgctgtctattggcctgctatgctaatgtctgctggtctg
aaccttccaaagatggtgtttggtcatggatttctcacaaaggatggaatgaagatgggg
aaatcgttggggaacactctagaaccttttgagctggttcagaaatttggaccagatgct
gttaggtacttcttcatccgggaggttgaatttggaaacgatggggactactcagaagac
cgttttataaaaattgtcaatgcacatctcgccaacacaataggaaacctccttaaccgt
actcttggccttctcaagaagaactgtgagtccactttagtagtagattccaccattgca
gccgaaggagttcctttgaaagacacagtagagaagctggttgaaaaggcacggacaaac
tatgagagcctgtcattatcaacggcgtgtgaggctgtgttagagattgggaatgcggga
aactcctacatggatcaaagagcaccttggatgcttttcaaacaaggtggtgtctcagca
gaagctgcagccaaggatctggtgattatactggaagtaatgagaatcatagcggttgcg
ttatcccccattgctccttgtttaagcctgaagatatattcacagcttgggttctcagtt
gatgagttcaatagcataacatgggatgataccaagtggggagagctaagggtaggtcaa
gttatggcgcaagctagtcctgtttttgtaagaatcgagctggatgcagcagagaaagat
gaagaggagaagaagccaaaggatagtaagaaaaagggtaaagctaaggtcaaagcagag
cagcaacctcagactatagcagaagcttaa

DBGET integrated database retrieval system