KEGG   Brassica napus (rape): 106398336Help
Entry
106398336         CDS       T04128                                 

Definition
(RefSeq) phosphoglucomutase, chloroplastic-like
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106398336
   00030 Pentose phosphate pathway
    106398336
   00052 Galactose metabolism
    106398336
   00500 Starch and sucrose metabolism
    106398336
   00520 Amino sugar and nucleotide sugar metabolism
    106398336
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106398336
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106398336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106398336
NCBI-ProteinID: XP_013694366
AA seq 628 aa AA seqDB search
MSSTYARFDTVFLLSRFAGAKYSPLWPSSSSSSSSHSSLLSSGTHLRAKPNSRLRSVTAA
SSGPIIAGSESIEIKSLPTKPIEGQKTGTSGLRKKVKVFMQDNYLANWIQALFNSLPLED
YKDATLVLGGDGRYFNKEASQIIIKIAAGNGVGKILVGQEGILSTPAVSAVIRKRKANGG
FIMSASHNPGGPEYDWGIKFNYSSGQPAPESITDKIYGNTLSISEIKVAEIPDIDLSHVG
VTKYGNFSVEVIDPVSDYLELMEDVFDFDLIRGLLSRSDFGFMFDAMHAVTGAYAKPIFV
DNLGAKPDSISNGVPLEDFGHGHPDPNLTYAKDLVDVMYRDDGPDFGAASDGDGDRNMVL
GNKFFVTPSDSVAIIAANAQEAIPYFRAGPKGLARSMPTSGALDRVAEKLKLPFFEVPTG
WKFFGNLMDAGKLSICGEESFGTGSDHIREKDGIWAVLAWLSILAHRNKDKKPGEKLVSV
ADVVNEYWATYGRNFFSRYDYEECESEGANKMIEYLRDIVAKSKAGVNYGNNVLQFADDF
SYTDPVDGSVASKQGVRFVFTDGSRIIFRLSGTGSAGATVRIYIEQFEPDVSKHDVDAQI
ALKPLIDLALSVSKLKEFTGREKPTVIT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgacctatgcgagattcgacaccgtttttctcctttctagattcgccggcgct
aagtactcgccgctgtggccttcttcttcatcatcgtcgtcgtcgcactcttctctctta
tcttccgggactcaccttagagccaagccgaattcgcgtttgcgatcggttacagcagca
tcgtctggtcctatcatcgccggaagcgaaagcattgagatcaaatcgttgccgacgaag
cctatcgaggggcagaagactggaactagcggcctccgcaagaaggtgaaagttttcatg
caagataattacctagccaactggatccaggcactgtttaattcattgcccctggaggac
tataaggacgccacattggttttaggaggtgatggtcgttacttcaacaaagaggcctcc
cagatcataatcaaaattgccgctgggaatggagttggaaaaattttagtcggacaggaa
ggcattttgtcaaccccagcggtttccgctgtaatcaggaaacgaaaggcaaatggagga
tttattatgagtgcaagtcataatcctggtggacctgaatatgactggggtatcaagttc
aattacagcagtggtcagccagctcctgaatccattactgacaaaatttatggaaataca
ctttcaatctctgagattaaggtggcagagattcccgacattgatctttctcatgttgga
gttactaaatatgggaatttcagtgtggaagttatagatcctgtttccgattacttggag
ctcatggaggatgtgtttgactttgatctcattagaggtcttctttcaagatcagatttt
gggttcatgtttgatgccatgcatgctgttactggtgcttatgcgaaaccaatttttgtc
gataatcttggagccaaaccggattcaatttccaatggagttcccctggaagattttggg
catggccatccagatcctaatttgacatacgcaaaggatttggttgatgtcatgtatcgt
gacgatggacctgatttcggagcagcaagtgatggtgatggtgacagaaatatggtctta
ggaaacaaattctttgtcactccttcagactctgttgctatcattgcagccaatgcacaa
gaagcaattccatatttccgtgctggtcctaagggtctagcacgttctatgccaactagt
ggtgctctggatcgtgttgccgagaagttgaagcttcctttcttcgaggttcccaccgga
tggaaattttttgggaatcttatggatgctggaaaattgtcaatctgtggagaagagagc
tttggcacaggttctgatcacatccgtgagaaggatggcatatgggctgtgttagcgtgg
ctttcgatcctagctcatcgcaacaaggacaagaaaccaggggagaagttagtttctgtt
gcagatgttgtgaacgagtactgggcgacatatggaaggaactttttttccagatacgac
tatgaagaatgtgaatctgaaggagccaataaaatgatcgaatatcttagagatatcgtg
gctaagagcaaggccggtgtaaattatggaaacaatgtcctccagtttgcagatgacttt
tcatacacggaccctgttgatggaagtgttgcatccaagcaaggtgttcggtttgtcttc
acggatggatccagaatcatatttcgtttatccggaactggttcagctggtgccacggtt
cgaatatacattgaacagtttgagccagacgtttcaaagcatgatgtggatgcacagata
gctctaaaacctttgatagatcttgcattgtctgtatcaaagctgaaggagtttacaggg
agggagaagcccactgtcattacatga

KEGG   Brassica napus (rape): 106401373Help
Entry
106401373         CDS       T04128                                 

Definition
(RefSeq) probable phosphoglucomutase, cytoplasmic 1
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106401373
   00030 Pentose phosphate pathway
    106401373
   00052 Galactose metabolism
    106401373
   00500 Starch and sucrose metabolism
    106401373
   00520 Amino sugar and nucleotide sugar metabolism
    106401373
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106401373
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106401373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106401373
NCBI-ProteinID: XP_013697332
AA seq 583 aa AA seqDB search
MVFKVSLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLQNFVQSTFNALTPAKVKGATLVVS
GDGRYYSNDAVQIIIKMAAANGVRRVWVGKNTLLSTPAVSAVIRERSGPDGSKATGGFIL
TASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKEYPIAEDLPIVDISAIGVS
SFEGPEGKFDVEVFDSADDYVKLMKSIFDFESIRKLLSSPKFSFCYDAMHGVAGAYAHRI
FVEELGSQENSLLNCVPKEDFGGGHPDPNLTYAKELVARMGLRQSDTGVEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAVGAIPYFSTGLKGVARSMPTSAALDVVAKSLNL
KFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDGIWAVLAWLSILAHKNKETL
DGDAKLVTVEDIVRKHWATYGRHYYTRYDYENVDAGKAKELMEHLVKLQSSIPEVNKMVK
GIRSDVANVSSADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIE
QYEKDASKTGRESHEALSPLVDIALKLSKMEEFTGRSAPTVIT
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaaggtctctctcgtctcaacctcccctatcgatggccagaaacctggcacc
tctggtctccgtaagaaggtgaaagtgttcaagcaacccaattacctacagaactttgtc
caatcaacttttaatgctcttactccagcgaaagtcaaaggtgccacactcgtggtctct
ggtgatggccgttattactcaaatgatgctgttcagatcattattaagatggcagcagct
aacggtgtgcgacgtgtgtgggttggtaaaaacactctcttatcaactcctgccgtatcg
gctgtgattcgtgaaagatcaggacctgatggatccaaggcaacaggaggatttatttta
acagcaagtcacaatcctggtggccctactgaggattttggaatcaaatacaatatggaa
aacgggggacctgctcctgaatcaatcactgataagatttacgagaacactaagacgatc
aaggagtacccaatagcagaagatctacccattgttgatatatctgccattggcgtatcc
agttttgaaggacctgaaggaaagtttgatgttgaagtttttgattccgcggatgactac
gttaaactaatgaagtccatcttcgactttgaatccatccggaagttgctttcatctcca
aagttttcattctgctatgatgcaatgcatggagttgctggagcctatgcccatcggatc
tttgtcgaagaactcggttcgcaagaaaattctctattgaactgcgtacccaaggaggac
tttggtggaggtcaccccgatcccaatctgacctatgctaaggagcttgtggcacgaatg
ggattacgtcaatccgacaccggagttgaacctccagagtttggtgctgctgctgatggt
gatgcagaccgtaacatgatccttggtaaaaggttctttgtaactccatctgattcggtt
gctataattgctgcaaatgctgttggggccataccttacttcagcactggtttgaaaggt
gttgcaaggagcatgccgacctcagcagctcttgatgtcgttgcaaagagcttgaatttg
aagttctttgaggttccaacaggctggaagttttttggtaatctgatggatgctggaatg
tgttctgtttgtggggaagaaagttttggaactgggtcggatcatatccgtgagaaagat
gggatttgggcagttcttgcgtggctgtccatacttgctcacaagaacaaggaaactctt
gatggtgacgctaaattggtgacggttgaagacattgtccgcaaacactgggctacctat
ggccgtcactattacactcgttacgactatgagaatgtagatgcaggtaaagctaaggaa
ctgatggagcatttggtcaaattgcaatcttcaatccctgaagtcaacaagatggtgaaa
ggaattcgctcggacgtggcgaatgtatccagtgcagatgaattcgagtacaaagatcca
gttgacggctccatctcgaagcaccagggaatccgttacctgtttgaagatggatcacga
cttgttttccgtctgtctggaactggctcggaaggagcaaccatccgactctacattgag
cagtacgagaaggatgcttctaaaaccggacgagagtcccatgaagctctgtctcctctg
gtggacatagctctgaaactgtccaagatggaggagttcacgggccgatcagcccccacc
gtcataacataa

KEGG   Brassica napus (rape): 106415353Help
Entry
106415353         CDS       T04128                                 

Definition
(RefSeq) probable phosphoglucomutase, cytoplasmic 1
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106415353
   00030 Pentose phosphate pathway
    106415353
   00052 Galactose metabolism
    106415353
   00500 Starch and sucrose metabolism
    106415353
   00520 Amino sugar and nucleotide sugar metabolism
    106415353
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106415353
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106415353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106415353
NCBI-ProteinID: XP_013711477
AA seq 583 aa AA seqDB search
MAFKVTLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTPEKVKGATLVVS
GDGRYYSKDAVQIIIKMAAANGVRRVWVGKNTLMSTPAVSAVIRERSGADGSKATGAFIL
TASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKEYPIAEDLPNVDISAVGVT
SFEGPEGKFDVEVFDSADDYVKLMKSIFDFESIRKLLSSPQFTFCYDALHGVAGAYAHRI
FVEELGAQESALLNCVPKEDFGGGHPDPNLTYAKELVARMGLSKSDTGGEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAIEAIPYFSSGLKGVARSMPTSAALDVVAKSLNL
KFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDGIWAVLAWMSILAHKNKDSI
DGDTKLVTVEDIVRQHWATYGRHYYTRYDYENVDAGKAKELMEHLVKLQSSIPEVNKIVK
GIRSDVANVSSADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIE
QYEKDASKIGRESQEALSPLVEIALKLSKMEEFTGRSAPTVIT
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaaggttactctcgtctccacatcccccatcgatggccagaaacccggaacc
tctggtctccgtaagaaggtgaaagtgttcaagcaacccaattacctggagaattttgtc
caagcaacgtttaatgcgcttactccggagaaagtcaaaggtgccacactcgtggtctct
ggtgatggtcgttattactcaaaggatgctgttcagattataattaagatggcagcagct
aatggtgtacgccgtgtgtgggttggtaaaaacactctgatgtcaacccctgctgtatca
gctgtgattcgtgaaagatcaggggctgatggatcgaaagcaactggagcatttatctta
acagcaagtcacaaccctggtggccctactgaggattttggaatcaaatacaatatggaa
aatggaggccctgctcctgaatccattactgataagatttacgagaacactaagacaatc
aaggagtaccctatagcagaagatctacccaatgttgatatttctgccgttggtgtaacg
agttttgagggacctgaaggaaaatttgatgttgaagtttttgattctgctgatgactac
gttaaactaatgaagtcaatcttcgactttgagtccatccgaaagttactttcatctcca
caatttacgttctgctacgatgccttgcacggtgttgctggggcctatgcgcatcgcatc
tttgtggaagaactcggtgcgcaagaaagtgccttgttgaactgcgtacccaaggaggac
tttggaggaggacatccagatcccaatctgacatatgctaaggagcttgtagcacggatg
ggactaagtaaatccgacaccggaggtgaacctccagagtttggtgccgctgctgatggt
gatgcagaccgtaacatgatccttggtaaaaggttctttgtaactccttcggattcagtt
gccataattgctgcaaatgccattgaagccataccatacttcagctctggtttaaaaggt
gttgcaaggagcatgccgacctcagctgctctagatgttgttgcaaaaagcttgaatttg
aagttttttgaggttccaacaggctggaagttttttggtaacctgatggatgccgggatg
tgttccgtctgtggtgaagaaagttttggaactggctccgatcatatccgtgagaaagat
gggatatgggcagttcttgcgtggatgtccatacttgctcacaagaacaaggatagcatt
gacggtgacactaaactggtgacggttgaagacattgtccgccagcactgggctacctat
ggccgtcactactacactcgctacgactacgagaatgtagacgcaggtaaagccaaggaa
ctgatggagcatttggtcaaattgcaatcttcaattcctgaagtcaacaagattgtgaaa
ggaattcgttcggatgtggcgaatgtctccagtgcggatgaattcgagtacaaagatcca
gttgatggatccatctcaaagcaccagggtatccgttacttgtttgaggatggatcgcga
cttgttttccgtctgtctggaactggctcggaaggagcaaccatcagactctacatcgaa
cagtacgagaaggatgcttcgaagattggacgagagtcccaggaagctctgtctcctctg
gttgagatagctctgaagctgtccaagatggaggagttcacgggccgatcagcccccacc
gtcataacttaa

KEGG   Brassica napus (rape): 106423685Help
Entry
106423685         CDS       T04128                                 

Definition
(RefSeq) phosphoglucomutase, chloroplastic
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106423685
   00030 Pentose phosphate pathway
    106423685
   00052 Galactose metabolism
    106423685
   00500 Starch and sucrose metabolism
    106423685
   00520 Amino sugar and nucleotide sugar metabolism
    106423685
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106423685
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106423685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106423685
NCBI-ProteinID: NP_001302927
UniProt: Q9SMM0
AA seq 629 aa AA seqDB search
MSSTYARFDTVFLLSRFAGAKYSPLWPSSSSSSHSSLLSSGIHLRAKPNSRLRSVTGASS
SSSGPIIAGSESIEIKSLPTKPIEGQKTGTSGLRKKVKVFMQDNYLANWIQALFNSLPLE
DYKDATLVLGGDGRYFNKEASQIIIKIAAGNGVGKILVGQEGILSTPAVSAVIRKRKANG
GFIMSASHNPGGPEYDWGIKFNYSSGQPAPESITDKIYGNTLSISEIKVAEIPDIDLSHV
GVTKYGNFSVEVIDPISDYLELMEDVFDFDLIRGLLSRSDFGFMFDAMHAVTGAYAKPIF
VDNLEAKPDSISNGVPLEDFGHGHPDPNLTYAKDLVDVMYRDDGPDFGAASDGDGDRNMV
LGNKFFVTPSDSVAIIAANAQEAIPYFRAGPKGLARSMPTSGALDRVAEKLKLPFFEVPT
GWKFFGNLMDAGKLSICGEESFGTGSDHIREKDGIWAVLAWLSILAHRIKDKKPGEKLVS
VADVVNEYWATYGRNFFSRYDYEECESEGANKMIEYLRDIVAKSKAGENYGNYVLQFADD
FSYKDPVDGSVASKQGVRFVFTDGSRIIYRLSGNGSAGATVRIYIEQFEPDVSKHDVDAQ
IAIKPLIDLALSVSKLKEFTGREKPTVIT
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgacctatgcgagattcgacaccgtttttctcctttctagattcgccggcgct
aagtactcgccgctgtggccttcttcttcatcgtcgtcgcactcttctctcttatcttcc
gggattcaccttagagccaagccgaattcgcgtttgcgatcggttacaggagcatcctct
tcatcgtctggtcctatcatcgccggaagtgaaagcattgagatcaaatcgttgccgacg
aagcctatcgaggggcagaagactggaacaagcggcctccggaagaaggtgaaagttttc
atgcaagataattacctagccaactggatccaggcattgtttaattcattgcccctggag
gactataaggacgccacattggttttaggaggtgatggtcgttacttcaacaaagaggcc
tcgcagatcataatcaaaattgcggctgggaatggagttggaaaaattttagttggacag
gaaggcattttgtcaaccccagcggtttccgctgtaatcaggaaacgaaaggcaaatgga
ggatttattatgagtgcaagtcataatcctggtggacctgaatatgactggggtatcaag
ttcaattacagcagtggtcagccagctcctgaatccattactgacaaaatttatggaaat
acactttcaatctctgagattaaggtggcagagattcccgacattgatctttctcatgtt
ggagttactaaatatgggaatttcagtgtggaagttatagatcctatttccgattacttg
gagctcatggaggatgtgtttgactttgatctcattagaggtcttctttcaagatcagat
tttgggttcatgtttgatgccatgcatgctgttactggtgcttatgcgaaaccaattttt
gtcgataatcttgaagccaaaccggattcaatttccaacggagttcccctggaagatttt
gggcatggccatccagatcctaatttgacatatgcaaaggatttggttgatgtcatgtat
cgtgacgatggacctgatttcggagcagcaagtgatggtgatggtgacagaaatatggtc
ttaggaaacaaattctttgtcactccttcagactctgttgctatcattgcagccaatgca
caagaagcaattccatatttccgtgctggtcctaagggtctagcacgttctatgccaact
agtggtgctctggatcgtgttgccgagaagttgaagcttcctttcttcgaggttcccacc
ggatggaaattttttggaaatcttatggatgctggaaaattgtcaatctgtggagaagag
agctttggcacaggttctgatcacatccgtgagaaggatggcatatgggctgtgttagcg
tggctttcgatcctagctcatcgcatcaaggacaagaaaccaggggagaagttggtttct
gttgcagatgttgtgaacgagtactgggcgacatatggaaggaactttttttccagatac
gactatgaagaatgtgaatctgaaggagccaataaaatgatcgaatatcttagagatatc
gtggctaagagcaaggccggtgaaaattatggaaactatgtcctccagtttgcagatgac
ttttcatacaaggaccctgttgatggaagtgttgcatccaagcaaggtgttcggtttgtc
ttcactgatggatccagaatcatatatcgtttatccggaaatggttcagctggtgccacg
gttagaatatatattgaacagtttgagccagacgtttcaaagcatgatgtggatgcccag
atagctataaaacctttgatagatcttgcattgtctgtatcaaagttgaaggagtttaca
gggagggagaagcccactgtcattacatga

KEGG   Brassica napus (rape): 106434227Help
Entry
106434227         CDS       T04128                                 

Definition
(RefSeq) probable phosphoglucomutase, cytoplasmic 1
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106434227
   00030 Pentose phosphate pathway
    106434227
   00052 Galactose metabolism
    106434227
   00500 Starch and sucrose metabolism
    106434227
   00520 Amino sugar and nucleotide sugar metabolism
    106434227
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106434227
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106434227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106434227
NCBI-ProteinID: XP_013730518
AA seq 583 aa AA seqDB search
MAFKVTLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTPEKVKGATLVVS
GDGRYYSKDAVQIIIKMAAANGVRRVWVGKNTLMSTPAVSAVIRERSGADGSKATGAFIL
TASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKEYPIAEDLPNVDVSAIGIT
SFEGPEGKFDVEVFDSADDYVKLMKSIFDFESIRKLLSSPKFTFCYDALHGVAGAYAHRI
FVEELGAQESALLNCVPKEDFGGGHPDPNLTYAKELVARMGLGKSDTGGEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAIEAIPYFSSGLKGVARSMPTSAALDVVAKSLNL
KFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDGIWAVLAWMSILAHKNKDSI
DGDTKLVTVEDIVRQHWATYGRHYYTRYDYENVDAGKAKELMEHLVKLQSSIPEVNKIVK
GIRSDVANVSSADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIE
QYEKDASKIGRESQEALSPLVDIALKLSKMEEFTGRSAPTVIT
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaaggttactctcgtctcaacatcccccatcgatggccagaagcccggaacc
tctggtctccgtaagaaggtgaaagtgttcaagcaacccaattaccttgagaattttgtg
caagcaacgtttaatgcgcttactcctgagaaagtcaaaggtgccacactcgtggtctct
ggtgatggtcgttattactcaaaggatgctgttcagatcataattaagatggcagcagct
aatggtgtacgccgtgtgtgggttggtaaaaacactctgatgtcaacccctgctgtatca
gctgtgattcgtgaaagatcaggggctgatggatcgaaagcaactggagcatttatctta
acagcaagtcacaaccctggtggccctactgaggattttggaatcaaatacaatatggaa
aatggaggccctgctcctgaatccattactgataagatttacgagaacactaagacaatc
aaggagtacccaatagcagaagatttacccaatgttgatgtttctgccattggtataacg
agttttgaaggacctgaaggaaaatttgatgttgaagtttttgattccgcagatgactac
gttaaactaatgaagtcaatcttcgactttgagtccatccgaaagttactttcatctcca
aaatttacgttctgctacgatgccttgcacggtgttgctggggcctatgcgcatcgcatc
tttgtggaagaactcggtgcgcaagaaagtgccttgttgaactgcgtacccaaggaggac
tttggcggaggacatccagatcccaatctgacatatgctaaggagcttgtagcacggatg
ggactaggtaaatccgacactggaggtgaacctccagagtttggtgccgctgctgatggt
gatgcagaccgtaacatgatccttggtaaaaggttctttgtaactccttcggattcagtt
gccattattgctgcaaatgccattgaagccatcccgtacttcagctctggtttgaaaggt
gttgcaaggagcatgccaacctcagctgctctagatgttgttgcaaaaagcttgaatttg
aagttctttgaggttccaacaggctggaagttttttggtaacctgatggatgccgggatg
tgttctgtctgtggagaagaaagttttggaactggctccgatcatatccgtgagaaagat
gggatatgggcagttcttgcgtggatgtccatacttgctcacaagaacaaggatagcata
gacggtgacactaaactggtgacggttgaagacattgtccgccagcactgggctacctat
ggccgtcactactacactcgttacgactatgagaatgtagacgcaggtaaagccaaggaa
ctgatggagcatttggttaaattgcaatcttcaattcctgaagtcaacaagattgtgaaa
ggaattcgttcggacgtggcgaatgtctccagtgcggatgagttcgagtacaaagatcca
gttgatggttccatctcaaagcaccagggtatccgttacttgtttgaggatggatcgcga
cttgttttccgtctgtctggaactggctcggaaggagcaaccatcaggctctacattgaa
cagtacgagaaggatgcttcgaagattggacgagagtcccaggaagctctgtctcctctg
gttgacatagctctgaagctgtccaagatggaggagttcacgggccgatcagcccccacc
gtcataacttaa

KEGG   Brassica napus (rape): 106440984Help
Entry
106440984         CDS       T04128                                 

Definition
(RefSeq) probable phosphoglucomutase, cytoplasmic 1
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00052  Galactose metabolism
bna00230  Purine metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106440984
   00030 Pentose phosphate pathway
    106440984
   00052 Galactose metabolism
    106440984
   00500 Starch and sucrose metabolism
    106440984
   00520 Amino sugar and nucleotide sugar metabolism
    106440984
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106440984
Enzymes [BR:bna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     106440984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 106440984
NCBI-ProteinID: XP_013738220
AA seq 583 aa AA seqDB search
MVFKVSLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLHNFVQSTFNALTPEKVKGATLVVS
GDGRYYSNDAVQIIIKMAAANGVRRVWVGKNTLLSTPAVSAVIRERSGADGSKATGGFIL
TASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKEYPIAEDLPIVDISAIGVS
SFEGPEGKFDVEVFDSADDYVKLMKSIFDFESIRKLLSSPKFSFCYDAMHGVAGAYAHRI
FVEELGAQESSLLNCVPKEDFGGGHPDPNLTYAKELVARMGLGKSDTGVEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAVGAIPYFSTGLKGVARSMPTSAALDVVAKSLNL
KFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDGIWAVLAWLSILAHKNKETL
DGDAKLVTVEDIVRKHWATYGRHYYTRYDYENVDAGKAKELMEHLVKLQSTIPEVNKMVK
GIRSDVANVSSADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIE
QYEKDASKTGRESHEALSPLVDIALKLSKMEEFTGRSAPTVIT
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcaaggtctctctcgtctcaacctcccccatcgatggccagaaacctggtacc
tctggtctccgtaagaaggtgaaagtgttcaagcaacccaattacctacacaactttgtc
caatcaacttttaatgctcttactccagagaaagtcaaaggtgccactcttgtggtctct
ggtgatggccgttattactcaaatgatgctgttcagatcattattaagatggcagcagct
aacggtgtgcgacgtgtgtgggttggtaaaaacactctcttatcaactcctgctgtatcg
gctgtgattcgtgaaagatcaggagctgatggatcgaaggcaacaggaggatttatttta
acagcaagtcacaatcctggtggccctactgaggattttggaatcaaatacaatatggaa
aacgggggacctgctcctgaatcaatcactgataagatttacgagaacactaagacgatc
aaggagtacccaatagcagaagatctacccattgttgatatatctgccattggcgtatcc
agttttgaaggacctgaaggaaagtttgatgttgaagtttttgattccgctgatgactac
gttaaactaatgaagtcaatcttcgactttgaatccatccggaagttgctttcatctcca
aagttttcattctgctatgatgcaatgcatggagttgctggagcctatgcacatcggatc
tttgtcgaagaactcggtgcgcaagaaagttctctattgaactgcgtacccaaggaggac
tttggtggaggtcatcccgatcccaatctgacctatgctaaggagcttgtggcacgaatg
ggattaggtaaatccgacaccggagttgaacctccagagtttggtgctgcggctgatggt
gatgcagaccgtaacatgatccttggtaaaaggttctttgtaactccatctgattcggtt
gctataattgctgcaaatgctgttggggccataccttacttcagcactggtttgaaaggt
gttgcaaggagcatgccgacctcagcagctcttgatgtcgttgcaaagagcttgaatttg
aagttctttgaggttccaacaggctggaagttttttggtaatctgatggatgctggaatg
tgttctgtttgtggggaagaaagttttggaactgggtcggaccatatccgtgagaaagat
gggatttgggcagttcttgcgtggctgtccatacttgctcacaagaacaaggaaactctt
gatggtgacgctaaattggtgacggttgaagacattgtccgcaaacactgggcaacctat
ggccgtcactattacactcgttacgactatgagaatgtagacgcaggtaaagctaaggaa
ctgatggagcatttggtcaaattgcaatctacaatccctgaagtcaacaagatggtgaaa
ggaattcgttcggacgtggctaacgtctcgagtgcggatgaattcgagtacaaagatcca
gttgatggctccatctccaagcaccagggaatccgttacttgtttgaagatggatcacga
cttgttttccgtctgtctggaactggctcggaaggagcaaccatccgactctacattgag
cagtacgagaaggatgcttctaaaaccggacgagagtcccatgaagctctgtctcctctg
gtggacatagctctgaagctgtccaaaatggaggagttcacgggccgatcagcccccacc
gtcataacataa

DBGET integrated database retrieval system